Crystal structure of human platelet-derived growth factor bb. Determined by X-ray diffraction at 3.0 Å resolution. Released 31 Jan 1994.
Explore 1PDG in 3D Show helices and sheets RCSB PDB PDBe
1PDG contains 3 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-24 | 8 | 1 |
| β-strand | 39-40 | 2 | 2 |
| β-strand | 43-50 | 8 | 1 |
| β-strand | 58-62 | 5 | 3 |
| β-strand | 65-78 | 14 | 2 |
| β-strand | 81-94 | 14 | 2 |
| β-strand | 97-101 | 5 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8 | 1 | |
| β-strand | 9-10 | 2 | 2 |
| α-helix | 11 | 1 | |
| β-strand | 13 | 1 | 1 |
| β-strand | 17-22 | 6 | 4 |
| β-strand | 45-50 | 6 | 4 |
| β-strand | 60-62 | 3 | 5 |
| β-strand | 65-74 | 10 | 6 |
| β-strand | 77-78 | 2 | 7 |
| β-strand | 81-82 | 2 | 7 |
| β-strand | 85-94 | 10 | 6 |
| β-strand | 97-99 | 3 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-11 | 3 | |
| β-strand | 17-19 | 3 | 8 |
| β-strand | 22 | 1 | 9 |
| β-strand | 45 | 1 | 9 |
| β-strand | 48-50 | 3 | 8 |
| β-strand | 61-65 | 5 | 10 |
| β-strand | 68-74 | 7 | 11 |
| β-strand | 77 | 1 | 12 |
| β-strand | 82 | 1 | 12 |
| β-strand | 85-91 | 7 | 11 |
| β-strand | 94-98 | 5 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Platelet-derived growth factor bb | A, B, C | protein | 109 | Homo sapiens | P01127 (AlphaFold model) |
>1PDG_1 PLATELET-DERIVED GROWTH FACTOR BB (chains A, B, C) SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQC RPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Crystal structure of human platelet-derived growth factor BB. Oefner, C., D'Arcy, A., Winkler, F.K. et al. EMBO J (1992) 11:3921-3926. PubMed
Other PDB entries of the same protein (UniProt P01127 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PDG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.