1PN7: 30S ribosomal protein S12
Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the 70S Cryo-EM map of E.coli ribosome. Determined by electron microscopy at 10.8 Å resolution. Released 15 Jul 2003.
- Method
- Electron microscopy
- Resolution
- 10.8 Å
- Organisms
- Thermus thermophilus, Thermotoga maritima
- Chains
- 3
- Atoms
- 319
- Mol. weight
- 48.12 kDa
- Released
- 15 Jul 2003
Explore 1PN7 in 3D
Show helices and sheets
RCSB PDB
PDBe
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| P-tRNA | C | RNA | 62 | | |
| 30S ribosomal protein S12 | O | protein | 124 | Thermus thermophilus | Q5SHN3 (AlphaFold model) |
| 50S ribosomal protein L11 | L | protein | 133 | Thermotoga maritima | P29395 (AlphaFold model) |
Sequence of entity 1 (C), FASTA
>1PN7_1 P-tRNA (chains C)
GCGGAUUUACUCAGGGGAGAGCCCAGAUAAAUGGAGUCUGUGCGUCCACAGAAUUCGCAC
CA
Sequence of entity 2 (O), FASTA
>1PN7_2 30S ribosomal protein S12 (chains O)
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGY
EVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKK
PKEA
Sequence of entity 3 (L), FASTA
>1PN7_3 50S ribosomal protein L11 (chains L)
QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVVITVYEDKSFT
FIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEEIAKTKMPDLNANSLEAAMKI
IEGTAKSMGIEVV
Primary citation
Locking and Unlocking of Ribosomal Motions. Valle, M., Zavialov, A., Sengupta, J. et al. Cell (2003) 114:123-134. DOI 10.1016/S0092-8674(03)00476-8 · PubMed
Other PDB entries of the same protein (UniProt Q5SHN3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9NO7 2.13 Å, Cryo-EM structure of the wild-type Thermus thermophilus 70S ribosome in complex with…
- 4Y4O 2.3 Å, Crystal structure of the Thermus thermophilus 70S ribosome with rRNA modifications and…
- 8CVL 2.3 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with mRNA,…
- 8FC6 2.35 Å, Crystal structure of the A2058-N6-dimethylated Thermus thermophilus 70S ribosome in…
- 8VTW 2.35 Å, Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with…
- 4W2F 2.4 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with amicoumacin,…
- 6XHV 2.4 Å, Crystal structure of the A2058-dimethylated Thermus thermophilus 70S ribosome in complex…
- 7RQA 2.4 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with protein Y,…
- 7RQE 2.4 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with protein Y,…
- 8CVJ 2.4 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with mRNA,…
- 8VTU 2.4 Å, Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with…
- 8VTX 2.4 Å, Crystal structure of the A2058-N6-dimethylated Thermus thermophilus 70S ribosome in…
Browse structure collections
About this viewer
MolViewer shows 1PN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.