1PND: Plastocyanin

Accuracy and precision in protein crystal structure analysis: two independent refinements of the structure of poplar plastocyanin at 173K. Determined by X-ray diffraction at 1.6 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Populus nigra
Chains: 1
Atoms: 910
Mol. weight: 10.56 kDa
Ligands: CU
Released: 31 Jan 1994

Explore 1PND in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PND contains 2 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	14-15	2	1
β-strand	18-21	4	2
β-strand	26-31	6	1
β-strand	37	1	3
β-strand	40-41	2	2
α-helix	52-54	3
β-strand	63	1	3
β-strand	69-73	5	1
β-strand	78-83	6	2
α-helix	85-87	3
β-strand	93-98	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin	A	protein	99	Populus nigra	P00299 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1PND_1 PLASTOCYANIN (chains A)
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEE
DLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN

Ligands and cofactors

ID	Name	Formula	Copies
CU	Copper (II) ion	Cu	1

Primary citation

Accuracy and precision in protein crystal structure analysis: two independent refinements of the structure of poplar plastocyanin at 173 K. Fields, B.A., Bartsch, H.H., Bartunik, H.D. et al. Acta Crystallogr D Biol Crystallogr (1994) 50:709-730. DOI 10.1107/S0907444994003021 · PubMed

Other PDB entries of the same protein (UniProt P00299 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DP9 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 6.0
4DPB 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 8.0
4DPA 1.05 Å, The 1.05 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 6.0
4DPC 1.06 Å, The 1.06 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 8.0
4DP8 1.07 Å, The 1.07 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 4.0
4DP7 1.08 Å, The 1.08 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 4.0
1PLC 1.33 Å, Accuracy and precision in protein crystal structure analysis: restrained least-squares…
1JXG 1.6 Å, The 1.6 A Resolution Crystal Structure of a Mutant Poplar Plastocyanin Bearing a 21-25…
1PNC 1.6 Å, Accuracy and precision in protein crystal structure analysis: two independent…
2PCY 1.8 Å, The crystal structure of poplar apoplastocyanin at 1.8-Å resolution. The geometry of the…
5PCY 1.8 Å, Crystal structure analyses of reduced (CUI) poplar plastocyanin at six PH values
3PCY 1.9 Å, The crystal structure of mercury-substituted poplar plastocyanin at 1.9-Å resolution

Browse structure collections

About this viewer

MolViewer shows 1PND directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.