Crystallization and structure determination of bovine profilin at 2.0 Å resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 31 Jul 1995.
Explore 1PNE in 3D Show helices and sheets RCSB PDB PDBe
1PNE contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-11 | 8 | |
| β-strand | 16-23 | 8 | 1 |
| β-strand | 29-33 | 5 | 1 |
| α-helix | 39-41 | 3 | |
| α-helix | 44-50 | 7 | |
| α-helix | 57-61 | 5 | |
| β-strand | 63-65 | 3 | 1 |
| β-strand | 68-75 | 8 | 1 |
| β-strand | 84-89 | 6 | 1 |
| β-strand | 99-104 | 6 | 1 |
| β-strand | 108-114 | 7 | 1 |
| α-helix | 115 | 1 | |
| α-helix | 120-136 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Profilin | A | protein | 140 | Bos taurus | P02584 (AlphaFold model) |
>1PNE_1 PROFILIN (chains A) XAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY
Crystallization and structure determination of bovine profilin at 2.0 A resolution. Cedergren-Zeppezauer, E.S., Goonesekere, N.C., Rozycki, M.D. et al. J Mol Biol (1994) 240:459-475. DOI 10.1006/jmbi.1994.1461 · PubMed
Other PDB entries of the same protein (UniProt P02584 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PNE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.