1PRT: Pertussis toxin
The crystal structure of pertussis toxin. Determined by X-ray diffraction at 2.9 Å resolution. Released 26 Jan 1995.
- Method
- X-ray diffraction
- Resolution
- 2.9 Å
- Organism
- Bordetella pertussis
- Chains
- 12
- Atoms
- 14,504
- Mol. weight
- 208.91 kDa
- Released
- 26 Jan 1995
Explore 1PRT in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
1PRT contains 68 α-helices and 117 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-11 | 6 | 1 |
| α-helix | 15-21 | 7 | |
| β-strand | 23-24 | 2 | 2 |
| β-strand | 29 | 1 | 3 |
| α-helix | 32-36 | 5 | |
| α-helix | 39-41 | 3 | |
| β-strand | 48 | 1 | 3 |
| β-strand | 50-54 | 5 | 1 |
| α-helix | 57-77 | 21 | |
| β-strand | 83-92 | 10 | 1 |
| β-strand | 97-99 | 3 | 1 |
| α-helix | 100-111 | 12 | |
| α-helix | 113-115 | 3 | |
| α-helix | 118-127 | 10 | |
| β-strand | 129-133 | 5 | 1 |
| β-strand | 135-136 | 2 | 2 |
| α-helix | 138-140 | 3 | |
| β-strand | 141-150 | 10 | 1 |
| β-strand | 156-162 | 7 | 1 |
| α-helix | 166-168 | 3 | |
| α-helix | 177-178 | 2 | |
| α-helix | 181-183 | 3 | |
| β-strand | 191-193 | 3 | 4 |
| β-strand | 198-199 | 2 | 4 |
| α-helix | 200-205 | 6 | |
| β-strand | 225-227 | 3 | 4 |
| α-helix | 228-230 | 3 | |
Chain B: 6 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-9 | 4 | |
| β-strand | 13 | 1 | 5 |
| β-strand | 18 | 1 | 6 |
| α-helix | 23-24 | 2 | |
| β-strand | 27-29 | 3 | 5 |
| α-helix | 32-35 | 4 | |
| α-helix | 39-46 | 8 | |
| β-strand | 54-56 | 3 | 6 |
| β-strand | 60-63 | 4 | 6 |
| α-helix | 65-67 | 3 | |
| β-strand | 70-73 | 4 | 6 |
| β-strand | 85 | 1 | 6 |
| β-strand | 87-89 | 3 | 5 |
| β-strand | 91-92 | 2 | 7 |
| β-strand | 100-114 | 15 | 7 |
| β-strand | 119-125 | 7 | 7 |
| β-strand | 128-135 | 8 | 7 |
| α-helix | 146-159 | 14 | |
| β-strand | 163-173 | 11 | 7 |
| β-strand | 184-191 | 8 | 7 |
Chain C: 8 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-12 | 3 | |
| β-strand | 13 | 1 | 8 |
| β-strand | 18-19 | 2 | 9 |
| β-strand | 22 | 1 | 9 |
| α-helix | 23-24 | 2 | |
| β-strand | 27-29 | 3 | 8 |
| α-helix | 32-37 | 6 | |
| α-helix | 39-48 | 10 | |
| α-helix | 49-50 | 2 | |
| β-strand | 54-56 | 3 | 9 |
| β-strand | 61-63 | 3 | 9 |
| β-strand | 70-72 | 3 | 9 |
| α-helix | 78-81 | 4 | |
| β-strand | 84-85 | 2 | 9 |
| β-strand | 87-89 | 3 | 8 |
| β-strand | 91-93 | 3 | 7 |
| β-strand | 100-113 | 14 | 7 |
| β-strand | 119-125 | 7 | 7 |
| β-strand | 128-135 | 8 | 7 |
| α-helix | 146-158 | 13 | |
| β-strand | 163-173 | 11 | 7 |
| β-strand | 183-191 | 9 | 7 |
| α-helix | 194-196 | 3 | |
Chains D and J: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-21 | 16 | 7 |
| β-strand | 24-36 | 13 | 7 |
| α-helix | 44-46 | 3 | |
| β-strand | 48-55 | 8 | 7 |
| α-helix | 63-74 | 12 | |
| β-strand | 77-89 | 13 | 7 |
| β-strand | 92-102 | 11 | 7 |
Chain E: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-20 | 15 | 7 |
| β-strand | 27-36 | 10 | 7 |
| α-helix | 44-46 | 3 | |
| β-strand | 48-55 | 8 | 7 |
| α-helix | 63-74 | 12 | |
| β-strand | 78-89 | 12 | 7 |
| β-strand | 92-102 | 11 | 7 |
Chain F: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-20 | 16 | 7 |
| β-strand | 23-31 | 9 | 7 |
| β-strand | 37-43 | 7 | 7 |
| α-helix | 51-66 | 16 | |
| β-strand | 70-74 | 5 | 7 |
| α-helix | 83 | 1 | |
| β-strand | 84-91 | 8 | 7 |
Chain G: 12 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-11 | 6 | 10 |
| α-helix | 15-21 | 7 | |
| β-strand | 23-24 | 2 | 11 |
| β-strand | 29 | 1 | 12 |
| α-helix | 32-36 | 5 | |
| β-strand | 48 | 1 | 12 |
| β-strand | 50-54 | 5 | 10 |
| α-helix | 57-77 | 21 | |
| β-strand | 83-92 | 10 | 10 |
| β-strand | 97-99 | 3 | 10 |
| α-helix | 100-111 | 12 | |
| α-helix | 113-115 | 3 | |
| α-helix | 118-126 | 9 | |
| β-strand | 129-133 | 5 | 10 |
| β-strand | 135-136 | 2 | 11 |
| α-helix | 138-140 | 3 | |
| β-strand | 141-150 | 10 | 10 |
| β-strand | 155-162 | 8 | 10 |
| α-helix | 166-168 | 3 | |
| β-strand | 174 | 1 | 10 |
| α-helix | 177-178 | 2 | |
| α-helix | 181-183 | 3 | |
| β-strand | 191-193 | 3 | 13 |
| β-strand | 198-199 | 2 | 13 |
| α-helix | 200-205 | 6 | |
| β-strand | 225-227 | 3 | 13 |
| α-helix | 228-231 | 4 | |
Chain H: 7 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 13 | 1 | 14 |
| β-strand | 18 | 1 | 15 |
| α-helix | 23-24 | 2 | |
| β-strand | 27-29 | 3 | 14 |
| α-helix | 30-31 | 2 | |
| α-helix | 32-35 | 4 | |
| α-helix | 39-46 | 8 | |
| β-strand | 54-56 | 3 | 15 |
| β-strand | 60-63 | 4 | 15 |
| α-helix | 65-67 | 3 | |
| β-strand | 70-73 | 4 | 15 |
| β-strand | 85 | 1 | 15 |
| β-strand | 87-89 | 3 | 14 |
| β-strand | 91-92 | 2 | 16 |
| β-strand | 100-114 | 15 | 16 |
| β-strand | 119-125 | 7 | 16 |
| β-strand | 128-135 | 8 | 16 |
| α-helix | 143-145 | 3 | |
| α-helix | 146-159 | 14 | |
| β-strand | 163-173 | 11 | 16 |
| β-strand | 183-191 | 9 | 16 |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Pertussis toxin (subunit S1) | A, G | protein | 234 | Bordetella pertussis | P04977 (AlphaFold model) |
| Pertussis toxin (subunit S2) | B, H | protein | 196 | Bordetella pertussis | P04978 (AlphaFold model) |
| Pertussis toxin (subunit S3) | C, I | protein | 196 | Bordetella pertussis | P04979 (AlphaFold model) |
| Pertussis toxin (subunit S4) | D, E, J, K | protein | 110 | Bordetella pertussis | P0A3R5 (AlphaFold model) |
| Pertussis toxin (subunit S5) | F, L | protein | 98 | Bordetella pertussis | P04981 |
Sequence of entity 1 (A, G), FASTA
>1PRT_1 PERTUSSIS TOXIN (SUBUNIT S1) (chains A, G)
DPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHLTGRSCQVGSSNSAFVSTSSSRRYTE
VYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAG
ALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSR
RSVASIVGTLVRMAPVVGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Sequence of entity 2 (B, H), FASTA
>1PRT_2 PERTUSSIS TOXIN (SUBUNIT S2) (chains B, H)
GIVIPPQEQITQHGSPYGRCANKTRALTVAELRGSGDLQEYLRHVTRGWSIFALYDGTYL
GGEYGGVIKDGTPGGAFDLKTTFCIMTTRNTGQPATDHYYSNVTATRLLSSTNSRLCAVF
VRSGQPVIGACTSPYDGKYWSMYSRLRKMLYLIYVAGISVRVHVSKEEQYYDYEDATFET
YALTGISICNPGSSLC
Sequence of entity 3 (C, I), FASTA
>1PRT_3 PERTUSSIS TOXIN (SUBUNIT S3) (chains C, I)
GIVIPPKALFTQQGGAYGRCPNGTRALTVAELRGNAELQTYLRQITPGWSIYGLYDGTYL
GQAYGGIIKDAPPGAGFIYRETFCITTIYKTGQPAADHYYSKVTATRLLASTNSRLCAVF
VRDGQSVIGACASPYEGRYRDMYDALRRLLYMIYMSGLAVRVHVSKEEQYYDYEDATFQT
YALTGISLCNPAASIC
Sequence of entity 4 (D, E, J, K), FASTA
>1PRT_4 PERTUSSIS TOXIN (SUBUNIT S4) (chains D, E, J, K)
DVPYVLVKTNMVVTSVAMKPYEVTPTRMLVCGIAAKLGAAASSPDAHVPFCFGKDLKRPG
SSPMEVMLRAVFMQQRPLRMFLGPKQLTFEGKPALELIRMVECSGKQDCP
Sequence of entity 5 (F, L), FASTA
>1PRT_5 PERTUSSIS TOXIN (SUBUNIT S5) (chains F, L)
LPTHLYKNFTVQELALKLKGKNQEFCLTAFMSGRSLVRACLSDAGHEHDTWFDTMLGFAI
SAYALKSRIALTVEDSPYPGTPGDLLELQICPLNGYCE
Primary citation
The crystal structure of pertussis toxin. Stein, P.E., Boodhoo, A., Armstrong, G.D. et al. Structure (1994) 2:45-57. DOI 10.1016/S0969-2126(00)00007-1 · PubMed
Other PDB entries of the same protein (UniProt P04977 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7SNE 1.0 Å, Pertussis toxin S1 subunit bound to BaAD
- 7SKI 1.1 Å, Pertussis toxin in complex with PJ34
- 7U6Z 1.3 Å, Pertussis toxin E129D NAD
- 7SKY 1.37 Å, Pertussis toxin S1 bound to NAD+
- 7SKK 1.65 Å, pertussis toxin in complex with ADPR and Nicotinamide
- 6RO0 2.13 Å, Crystal structure of genetically detoxified pertussis toxin gdpt.
- 1BCP 2.7 Å, Binary complex of pertussis toxin and ATP
- 1PTO 3.5 Å, The structure of a pertussis toxin-sugar complex as a model for receptor binding
- 9MR7 3.56 Å, Genetiocally detoxified pertussis toxin in complex with hu1B7 Fab and hu11E6 Fab
Browse more
1PRT is part of these collections:
About this viewer
MolViewer shows 1PRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.