Crystal structure of toxin II from the scorpion androctonus australis hector refined at 1.3 Å resolution. Determined by X-ray diffraction at 1.3 Å resolution. Released 26 Jan 1995.
Explore 1PTX in 3D Show helices and sheets RCSB PDB PDBe
1PTX contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| β-strand | 6 | 1 | 2 |
| β-strand | 7 | 1 | 3 |
| β-strand | 13 | 1 | 3 |
| α-helix | 19-28 | 10 | |
| β-strand | 33-41 | 9 | 1 |
| β-strand | 43-51 | 9 | 1 |
| β-strand | 57 | 1 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Scorpion toxin II | A | protein | 64 | Androctonus australis | P01484 (AlphaFold model) |
>1PTX_1 SCORPION TOXIN II (chains A) VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGP GRCH
Crystal structure of toxin II from the scorpion Androctonus australis Hector refined at 1.3 A resolution. Housset, D., Habersetzer-Rochat, C., Astier, J.P. et al. J Mol Biol (1994) 238:88-103. DOI 10.1006/jmbi.1994.1270 · PubMed
Other PDB entries of the same protein (UniProt P01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1PTX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.