1PV7: Lactose permease with TDG

Crystal structure of lactose permease with TDG. Determined by X-ray diffraction at 3.6 Å resolution. Released 12 Aug 2003.

Method: X-ray diffraction
Resolution: 3.6 Å
Organism: Escherichia coli
Chains: 2
Atoms: 6,626
Mol. weight: 93.69 kDa
Released: 12 Aug 2003

Explore 1PV7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PV7 contains 55 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 0 β-strands

Element	Residues	Length
α-helix	2-5	4
α-helix	7-38	32
α-helix	42-58	17
α-helix	60-70	11
α-helix	75-85	11
α-helix	87-89	3
α-helix	90-95	6
α-helix	96-100	5
α-helix	104-109	6
α-helix	114-118	5
α-helix	121-136	16
α-helix	140-164	25
α-helix	166-185	20
α-helix	199-202	4
α-helix	210-216	7
α-helix	221-226	6
α-helix	227-233	7
α-helix	234-247	14
α-helix	254-276	23
α-helix	279-286	8
α-helix	288-307	20
α-helix	312-340	29
α-helix	343-345	3
α-helix	346-348	3
α-helix	349-355	7
α-helix	358-376	19
α-helix	378-399	22
α-helix	408-416	9

Chain B: 27 helices, 0 β-strands

Element	Residues	Length
α-helix	2-5	4
α-helix	7-38	32
α-helix	42-58	17
α-helix	60-69	10
α-helix	75-85	11
α-helix	87-90	4
α-helix	91-95	5
α-helix	96-100	5
α-helix	104-109	6
α-helix	114-118	5
α-helix	121-136	16
α-helix	140-164	25
α-helix	166-185	20
α-helix	199-202	4
α-helix	210-216	7
α-helix	221-228	8
α-helix	229-234	6
α-helix	235-247	13
α-helix	254-286	33
α-helix	288-307	20
α-helix	312-340	29
α-helix	343-345	3
α-helix	346-348	3
α-helix	349-355	7
α-helix	358-376	19
α-helix	378-399	22
α-helix	408-416	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lactose permease	A, B	protein	417	Escherichia coli	P02920 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1PV7_1 Lactose permease (chains A, B)
MYYLKNTNFWMFGLFFFFYFFIMGAYFPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQ
PLFGLLSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLGFCFNA
GAPAVEAFIEKVSRRSNFEFGRARMFGCVGWALGASIVGIMFTINNQFVFWLGSGCALIL
AVLLFFAKTDAPSSATVANAVGANHSAFSLKLALELFRQPKLWFLSLYVIGVSCTYDVFD
QQFANFFTSFFATGEQGTRVFGYVTTMGELLNASIMFFAPLIINRIGGKNALLLAGTIMS
VRIIGSSFATSALEVVILKTLHMFEVPFLLVGCFKYITSQFEVRFSATIYLVCFCFFKQL
AMIFMSVLAGNMYESIGFQGAYLVLGLVALGFTLISVFTLSGPGPLSLLRRQVNEVA

Primary citation

Structure and mechanism of the lactose permease of Escherichia coli. Abramson, J., Smirnova, I., Kasho, V. et al. Science (2003) 301:610-615. DOI 10.1126/science.1088196 · PubMed

Other PDB entries of the same protein (UniProt P02920 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9XOU 2.5 Å, CryoEM structure of LacY with Trimbody
6VBG 2.8 Å, Lactose permease complex with thiodigalactoside and nanobody 9043
2CFQ 2.95 Å, Sugar Free Lactose Permease at neutral pH
8YA0 2.97 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C)
6C9W 3.0 Å, Crystal Structure of a ligand bound LacY/Nanobody Complex
8YA3 3.27 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+7C) treated with DTT
8Y9Y 3.29 Å, Structure of the SecA-SecY complex with the substrate FtsQ-LacY(+1C)
2CFP 3.3 Å, Sugar Free Lactose Permease at acidic pH
5GXB 3.3 Å, crystal structure of a LacY/Nanobody complex
4ZYR 3.31 Å, Crystal structure of E. coli Lactose permease G46W/G262W bound to p-nitrophenyl…
2Y5Y 3.38 Å, Crystal structure of LacY in complex with an affinity inactivator
1PV6 3.5 Å, Crystal structure of lactose permease

Browse structure collections

About this viewer

MolViewer shows 1PV7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.