1Q0P: A domain of Factor B

A domain of Factor B. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Mar 2004.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,685
Mol. weight: 25.23 kDa
Ligands: MN
Released: 30 Mar 2004

Explore 1Q0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q0P contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	244-251	8	1
α-helix	258-276	19
β-strand	283-289	7	1
β-strand	293-297	5	1
α-helix	302-305	4
α-helix	307-315	9
α-helix	330-341	12
α-helix	348-349	2
α-helix	352-354	3
β-strand	356-363	8	1
α-helix	374-383	10
β-strand	389	1	2
β-strand	392	1	2
α-helix	395-397	3
β-strand	398-404	7	1
α-helix	411-417	7
β-strand	427-429	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement factor B	A	protein	223	Homo sapiens	P00751 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q0P_1 Complement factor B (chains A)
GEQQKRKIVLDPSGSMNIYLVLDGSDSIGASNFTGAKKSLVNLIEKVASYGVKPRYGLVT
YATYPKIWVKVSEADSSNADWVTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVP
PEGWNRTRHVIILMTDGLHNMGGDPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPL
VNQVNINALASKKDNEQHVFKVKDMENLEDVFYQMIDESQSLS

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	1

Primary citation

Crystal Structure of the A Domain from Complement Factor B Reveals an Integrin-like Open Conformation. Bhattacharya, A.A., Lupher Jr., M.L., Staunton, D.E. et al. Structure (2004) 12:371-378. DOI 10.1016/j.str.2004.02.012 · PubMed

Other PDB entries of the same protein (UniProt P00751 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QSW 1.64 Å, Complement factor B protease domain in complex with the reversible inhibitor…
6RAV 1.7 Å, Complement factor B protease domain in complex with the reversible inhibitor…
6T8W 1.7 Å, Complement factor B in complex with (-)-4-(1-((5,7-Dimethyl-1H-indol-4-yl)methyl)piperidi…
6QSX 1.77 Å, Complement factor B protease domain in complex with the reversible inhibitor…
1RRK 2.0 Å, Crystal Structure Analysis of the Bb segment of Factor B
1DLE 2.1 Å, Factor B serine protease domain
3HRZ 2.2 Å, Cobra Venom Factor (CVF) in complex with human factor B
6T8V 2.29 Å, Complement factor B in complex with (S)-5,7-Dimethyl-4-((2-phenylpiperidin-1-yl)methyl)-1…
1RTK 2.3 Å, Crystal Structure Analysis of the Bb segment of Factor B complexed with…
2OK5 2.3 Å, Human Complement factor B
1RS0 2.6 Å, Crystal Structure Analysis of the Bb segment of Factor B complexed with…
9U62 2.7 Å, AP pathways C3 convertase C3bBbP and C3 complex

Browse structure collections

About this viewer

MolViewer shows 1Q0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.