1Q1A: HST2 protein

Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-acetyl ADP ribose and histone peptide. Determined by X-ray diffraction at 1.5 Å resolution. Released 18 Nov 2003.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,698
Mol. weight: 34.52 kDa
Ligands: OAD, ZN
Released: 18 Nov 2003

Explore 1Q1A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q1A contains 18 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	9-21	13
β-strand	27-31	5	1
α-helix	33-39	7
α-helix	51-53	3
α-helix	56-58	3
α-helix	63-67	5
β-strand	68	1	2
α-helix	69-74	6
α-helix	77-86	10
α-helix	95-105	11
β-strand	109-114	6	1
α-helix	120-123	4
α-helix	128-130	3
β-strand	131-133	3	1
β-strand	136-143	8	3
β-strand	149-150	2	3
α-helix	152-159	8
β-strand	169	1	4
β-strand	176	1	4
β-strand	177-181	5	3
β-strand	184	1	2
β-strand	187	1	5
α-helix	188-189	2
α-helix	190-208	19
β-strand	218-222	5	1
β-strand	228-229	2	6
α-helix	233-237	5
β-strand	243-247	5	1
α-helix	254-257	4
β-strand	264-266	3	1
α-helix	270-281	12
α-helix	284-291	8

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	352	1	5
β-strand	354-355	2	6
α-helix	356-357	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HST2 protein	A	protein	289	Saccharomyces cerevisiae	P53686 (AlphaFold model)
Histone H4	B	protein	10		P02309 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q1A_1 HST2 protein (chains A)
TASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPE
AVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQA
GVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFF
GEDLPDSFSETWLNDSEWLREKITTSGKHPQQPLVIVVGTSLAVYPFASLPEEIPRKVKR
VLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTA

Sequence of entity 2 (B), FASTA

>1Q1A_2 Histone H4 (chains B)
KGGAKRHRKI

Ligands and cofactors

ID	Name	Formula	Copies
OAD	2'-O-acetyl adenosine-5-diphosphoribose	C17 H25 N5 O15 P2	1
ZN	Zinc ion	Zn	1

Primary citation

Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-Acetyl ADP ribose and histone peptide. Zhao, K., Chai, X., Marmorstein, R. Structure (2003) 11:1403-1411. DOI 10.1016/j.str.2003.09.016 · PubMed

Other PDB entries of the same protein (UniProt P53686 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1SZD 1.5 Å, Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent…
1SZC 1.75 Å, Structural basis for nicotinamide cleavage and ADP-ribose transfer by NAD+-dependent…
7F4E 1.78 Å, Crystal structure of Hst2 in complex with H3K9bz peptide
7F51 1.98 Å, Crystal structure of Hst2 in complex with 2'-O-Benzoyl ADP Ribose
2OD2 2.0 Å, Crystal Structure of yHst2 I117F mutant bound to carba-NAD+ and an acetylated H4 peptide
2OD7 2.0 Å, Crystal Structure of yHst2 bound to the intermediate analogue ADP-HPD, and and aceylated…
2QQF 2.0 Å, Hst2 bound to ADP-HPD and Acetylated histone H4
2OD9 2.05 Å, Structural Basis for Nicotinamide Inhibition and Base Exchange in Sir2 Enzymes
2QQG 2.05 Å, Hst2 bound to ADP-HPD, acetyllated histone H4 and nicotinamide
1Q14 2.5 Å, Structure and autoregulation of the yeast Hst2 homolog of Sir2
1Q17 2.7 Å, Structure of the yeast Hst2 protein deacetylase in ternary complex with 2'-O-acetyl ADP…

Browse structure collections

About this viewer

MolViewer shows 1Q1A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.