1Q1E: PDB entry 1Q1E

The ATPase component of E. coli maltose transporter (MalK) in the nucleotide-free form. Determined by X-ray diffraction at 2.9 Å resolution. Released 30 Sept 2003.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Escherichia coli
Chains: 2
Atoms: 5,706
Mol. weight: 84.37 kDa
Released: 30 Sept 2003

Explore 1Q1E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q1E contains 30 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	1
β-strand	16-25	10	1
β-strand	31-35	5	2
α-helix	42-50	9
β-strand	57-62	6	1
β-strand	65-66	2	1
α-helix	72-75	4
β-strand	77-79	3	2
α-helix	92-102	11
α-helix	107-120	14
α-helix	131-133	3
α-helix	136-148	13
β-strand	154-157	4	2
α-helix	167-183	17
β-strand	186-191	6	2
α-helix	194-200	7
β-strand	203-208	6	2
β-strand	211-216	6	2
α-helix	218-223	6
β-strand	227	1	3
α-helix	228-233	6
α-helix	238-239	2
β-strand	240-248	9	4
β-strand	255-257	3	4
β-strand	265-267	3	4
β-strand	270	1	5
β-strand	280-285	6	4
α-helix	287-289	3
β-strand	291	1	6
β-strand	299-309	11	6
β-strand	313-319	7	6
α-helix	326	1
β-strand	327-332	6	6
β-strand	342-346	5	6
α-helix	349-351	3
β-strand	353-355	3	4
β-strand	360	1	3
β-strand	361	1	4
β-strand	364	1	5

Chain B: 16 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5-13	9	7
β-strand	16-25	10	7
β-strand	31-35	5	8
α-helix	42-50	9
β-strand	57-62	6	7
β-strand	65-66	2	7
α-helix	72-74	3
β-strand	77-79	3	8
α-helix	92-102	11
α-helix	107-120	14
α-helix	124-126	3
α-helix	131-133	3
α-helix	136-148	13
β-strand	154-157	4	8
α-helix	167-183	17
β-strand	186-191	6	8
α-helix	194-200	7
β-strand	203-208	6	8
β-strand	211-216	6	8
α-helix	218-223	6
β-strand	227	1	9
α-helix	228-231	4
α-helix	238-239	2
β-strand	240-250	11	10
β-strand	253-257	5	10
β-strand	265-268	4	10
β-strand	280-285	6	10
α-helix	287-289	3
β-strand	291	1	11
β-strand	298-309	12	11
β-strand	313-319	7	11
α-helix	326	1
β-strand	327-332	6	11
β-strand	342-347	6	11
α-helix	349-351	3
β-strand	353-355	3	10
β-strand	360	1	9
β-strand	361	1	10
α-helix	366-368	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin transport ATP-binding protein malK	A, B	protein	381	Escherichia coli	P68187 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Q1E_1 Maltose/maltodextrin transport ATP-binding protein malK (chains A, B)
MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL
FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV
LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLH
KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN
FLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVIL
EGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGT
ACRRLHKEPGVASASHHHHHH

Primary citation

A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle. Chen, J., Lu, G., Lin, J. et al. Mol Cell (2003) 12:651-661. DOI 10.1016/j.molcel.2003.08.004 · PubMed

Other PDB entries of the same protein (UniProt P68187 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RLF 2.2 Å, Crystal structure of the maltose-binding protein/maltose transporter complex in an…
2AWN 2.3 Å, Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ATP-Mg)
3PUW 2.3 Å, Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to ADP-AlF4
3PUX 2.3 Å, Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to ADP-BeF3
4KI0 2.38 Å, Crystal structure of the maltose-binding protein/maltose transporter complex in an…
3PUV 2.4 Å, Crystal Structure of an outward-facing MBP-Maltose transporter complex bound to ADP-VO4
1Q12 2.6 Å, Crystal Structure of the ATP-bound E. coli MalK
3GD7 2.7 Å, Crystal structure of human NBD2 complexed with N6-Phenylethyl-ATP (P-ATP)
1Q1B 2.8 Å, Crystal structure of E. coli MalK in the nucleotide-free form
2AWO 2.8 Å, Crystal structure of the ADP-Mg-bound E. Coli MALK (Crystallized with ADP-Mg)
3PUZ 2.9 Å, Crystal Structure of a pre-translocation state MBP-Maltose transporter complex bound to…
4KHZ 2.9 Å, Crystal structure of the maltose-binding protein/maltose transporter complex in an…

Browse structure collections

About this viewer

MolViewer shows 1Q1E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.