1Q1P: E-Cadherin activation

E-Cadherin activation. Determined by X-ray diffraction at 3.2 Å resolution. Released 20 Apr 2004.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Mus musculus
Chains: 1
Atoms: 1,864
Mol. weight: 23.27 kDa
Ligands: CA
Released: 20 Apr 2004

Explore 1Q1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q1P contains 3 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
β-strand	19-23	5	2
β-strand	34-39	6	1
β-strand	51	1	2
β-strand	59-62	4	2
β-strand	73-82	10	1
β-strand	86-87	2	1
α-helix	90-91	2
β-strand	92-99	8	1
β-strand	107-108	2	3
β-strand	112-115	4	4
β-strand	118	1	5
β-strand	126-129	4	6
β-strand	132-133	2	3
α-helix	142-144	3
β-strand	148-152	5	4
β-strand	163-165	3	6
β-strand	171-174	4	6
β-strand	188-194	7	4
α-helix	195-198	4
β-strand	202-209	8	4
β-strand	212	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epithelial-cadherin	A	protein	212	Mus musculus	P09803 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q1P_1 Epithelial-cadherin (chains A)
WVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETGWLK
VTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVAEGA
VPGTSVMKVSATDADDDVNTYNAAIAYTIVSQDPELPHKNMFTVNRDTGVISVLTSGLDR
ESYPTYTLVVQAADLQGEGLSTTAKAVITVKD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

Proteolytic E-cadherin activation followed by solution NMR and X-ray crystallography. Haussinger, D., Ahrens, T., Aberle, T. et al. EMBO J (2004) 23:1699-1708. DOI 10.1038/sj.emboj.7600192 · PubMed

Other PDB entries of the same protein (UniProt P09803 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QRB 1.8 Å, crystal structure of E-cadherin EC1-2 P5A P6A
2OMW 1.85 Å, Crystal structure of InlA S192N Y369S/mEC1 complex
1EDH 2.0 Å, E-cadherin domains 1 and 2 in complex with calcium
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
3LNE 2.0 Å, Crystal structure of E-cadherin EC12 K14E
3LNI 2.3 Å, Crystal structure of E-cadherin EC12 E89A
2QVF 2.4 Å, mouse E-cadherin domains 1,2
4QD2 2.4 Å, Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
3LNF 2.5 Å, Crystal structure of E-cadherin EC12 K14EW2A
3LNH 2.6 Å, Crystal structure of E-cadherin EC12 W2A
7AR4 2.6 Å, Crystal structure of beta-catenin in complex with cyclic peptide inhibitor
3LNG 2.7 Å, Crystal structure of E-cadherin EC12 AA extension

Browse structure collections

About this viewer

MolViewer shows 1Q1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.