1Q1T: Large T antigen

Mouse Importin alpha: non-phosphorylated SV40 CN peptide complex. Determined by X-ray diffraction at 2.5 Å resolution. Released 30 Mar 2004.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,710
Mol. weight: 55.83 kDa
Released: 30 Mar 2004

Explore 1Q1T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q1T contains 34 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	124-126	3

Chain C: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	71-73	3
α-helix	78-85	8
α-helix	90-103	14
α-helix	112-117	6
α-helix	121-128	8
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-212	7
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-452	19
α-helix	457-466	10
α-helix	470-476	7
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Large T antigen	A, B	protein	25		P03070 (AlphaFold model)
Importin alpha-2 subunit	C	protein	466	Mus musculus	P52293 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1Q1T_1 Large T antigen (chains A, B)
PGSDDEAAADAQHAAPPKKKRKVEY

Sequence of entity 2 (C), FASTA

>1Q1T_2 Importin alpha-2 subunit (chains C)
MADIGSNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPK
FVSFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAV
WALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPA
PPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLG
ATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNIT
AGRQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIE
PLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENES
VYKASLNLIEKYFSVEEEEDQNVVPETTSEGFAFQVQDGAPGTFNF

Primary citation

Role of flanking sequences and phosphorylation in the recognition of the simian-virus-40 large T-antigen nuclear localization sequences by importin-alpha. Fontes, M.R.M., Teh, T., Toth, G. et al. Biochem J (2003) 375:339-349. DOI 10.1042/BJ20030510 · PubMed

Other PDB entries of the same protein (UniProt P03070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FUF 1.45 Å, Crystal structure of the SV40 large T antigen origin-binding domain
2IPR 1.5 Å, Origin binding domain of the SV40 large T antigen (residues 131-259). P21 crystal form
3QK2 1.64 Å, Structure-Based Analysis of the Interaction between the Simian Virus 40 T-Antigen Origin…
2ITL 1.65 Å, The origin binding domain of the SV40 large T antigen bound to the functional pen…
3QN2 1.66 Å, Structure-based design of a disulfide-linked oligomeric form of the Simian Virus 40…
5D9I 1.7 Å, SV40 Large T antigen origin binding domain bound to artificial DNA fork
4RXH 1.76 Å, Crystal Structure of Importin-alpha from Neurospora crassa complexed with SV40NLS
1SVM 1.94 Å, Co-crystal structure of SV40 large T antigen helicase domain and ATP
1SVL 1.95 Å, Co-crystal structure of SV40 large T antigen helicase domain and ADP
1Q1S 2.3 Å, Mouse Importin alpha- phosphorylated SV40 CN peptide complex
2NL8 2.3 Å, The origin binding domain of the SV40 large T antigen bound non specifically to a 17 bp…
2NTC 2.4 Å, Crystal Structure of sv40 large T antigen origin binding domain with DNA

Browse structure collections

About this viewer

MolViewer shows 1Q1T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.