1Q1U: Human FHF1b

Crystal structure of human FHF1b (FGF12b). Determined by X-ray diffraction at 1.7 Å resolution. Released 5 Aug 2003.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,142
Mol. weight: 16.75 kDa
Released: 5 Aug 2003

Explore 1Q1U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q1U contains 5 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-10	2
β-strand	11-17	7	1
β-strand	21-25	5	1
β-strand	31-34	4	1
α-helix	40-42	3
β-strand	44-50	7	1
β-strand	53-58	6	1
β-strand	64-67	4	1
β-strand	73-76	4	1
α-helix	81-83	3
β-strand	85-90	6	1
β-strand	94-103	10	1
β-strand	110-112	3	1
β-strand	115	1	2
β-strand	120	1	1
β-strand	121	1	2
α-helix	124-126	3
α-helix	132-134	3
β-strand	136-140	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
fibroblast growth factor homologous factor 1	A	protein	144	Homo sapiens	P61328 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Q1U_1 fibroblast growth factor homologous factor 1 (chains A)
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVK
ASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQ
IMKGNRVKKTKPSSHFVPKPIEVA

Primary citation

Fibroblast growth factor (FGF) homologous factors share structural but not functional homology with FGFs. Olsen, S.K., Garbi, M., Zampieri, N. et al. J Biol Chem (2003) 278:34226-34236. DOI 10.1074/jbc.M303183200 · PubMed

Other PDB entries of the same protein (UniProt P61328 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQ0 3.84 Å, Voltage-gated sodium channel 1.5 C-terminal domain in complex with FGF12B and…

Browse structure collections

About this viewer

MolViewer shows 1Q1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.