1Q9O: S45-18 Fab Unliganded

S45-18 Fab Unliganded. Determined by X-ray diffraction at 1.79 Å resolution. Released 27 Jan 2004.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Mus musculus
Chains: 4
Atoms: 7,379
Mol. weight: 97.6 kDa
Ligands: MG
Released: 27 Jan 2004

Explore 1Q9O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Q9O contains 30 α-helices and 93 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	13
β-strand	10-14	5	14
β-strand	19-25	7	13
β-strand	30-30A	2	15
β-strand	30F-31	2	15
β-strand	33-38	6	14
β-strand	45-49	5	14
β-strand	53-54	2	14
α-helix	55	1
β-strand	62-67	6	13
β-strand	70-75	6	13
α-helix	80-82	3
β-strand	84-90	7	14
β-strand	96-97	2	14
β-strand	101-106	6	14
β-strand	110	1	16
α-helix	111-112	2
β-strand	113-117	5	17
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-138	11	17
β-strand	139	1	16
β-strand	143-149	7	18
β-strand	152-154	3	18
β-strand	158-162	5	17
α-helix	163-166	4
β-strand	172-181	10	17
α-helix	182-186	5
β-strand	190-197	8	18
β-strand	204-209	6	18
α-helix	210-212	3

Chain B: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	46-51	6	3
α-helix	52B-52D	3
β-strand	55-57	3	3
β-strand	62	1	1
β-strand	65-70	6	1
β-strand	75-80	6	1
α-helix	84-86	3
β-strand	88-94	7	3
β-strand	100E-101	2	3
β-strand	105-107	3	3
β-strand	108-109	2	2
α-helix	113-114	2
β-strand	115	1	4
β-strand	118-122	5	5
β-strand	133-143	11	5
β-strand	144	1	4
β-strand	149-152	4	6
α-helix	153-155	3
β-strand	157	1	6
β-strand	161-163	3	5
α-helix	164-166	3
β-strand	167-169	3	5
β-strand	172-182	11	5
β-strand	192-197	6	6
α-helix	198-200	3
β-strand	202-207	6	6

Chain C: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	19
β-strand	10-14	5	20
β-strand	19-25	7	19
β-strand	30	1	21
β-strand	31	1	21
β-strand	33-38	6	20
β-strand	45-49	5	20
β-strand	53-54	2	20
α-helix	55	1
β-strand	62-67	6	19
β-strand	70-75	6	19
α-helix	80-82	3
β-strand	84-90	7	20
β-strand	96-97	2	20
β-strand	101-106	6	20
β-strand	110	1	22
β-strand	113-117	5	23
α-helix	118-120	3
α-helix	121-126	6
β-strand	128-138	11	23
β-strand	139	1	22
β-strand	143-149	7	24
β-strand	152-153	2	24
α-helix	154	1
β-strand	158-162	5	23
α-helix	163-166	4
β-strand	172-181	10	23
α-helix	182-186	5
β-strand	191-197	7	24
β-strand	204-208	5	24

Chain D: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	11-12	2	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	9
β-strand	46-51	6	9
α-helix	52B-52D	3
β-strand	55-57	3	9
β-strand	62	1	7
β-strand	65-70	6	7
β-strand	75-80	6	7
α-helix	84-86	3
β-strand	88-94	7	9
β-strand	100E-101	2	9
β-strand	105-107	3	9
β-strand	108-109	2	8
α-helix	113-114	2
β-strand	115	1	10
β-strand	118-122	5	11
β-strand	133-143	11	11
β-strand	144	1	10
β-strand	149-152	4	12
α-helix	153-155	3
β-strand	161-163	3	11
α-helix	164-166	3
β-strand	167-169	3	11
β-strand	172-182	11	11
α-helix	183-185	3
β-strand	192-197	6	12
α-helix	198-200	3
β-strand	202-207	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S45-2 Fab (IgG1k) heavy chain	B, D	protein	226	Mus musculus	I6L985 (AlphaFold model)
S45-2 Fab (IgG1k) light chain	A, C	protein	219	Mus musculus	P01837 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>1Q9O_1 S45-2 Fab (IgG1k) heavy chain (chains B, D)
EVILVESGGGLVQPGGSLRLSCSTSGFTFTDYYMSWVRQPPGKALEWLGFIRNKPKGYTT
EYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCVRDIYSFGSRDGMDYWGQGTSV
TVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAV
LQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC

Sequence of entity 2 (A, C), FASTA

>1Q9O_2 S45-2 Fab (IgG1k) light chain (chains A, C)
DIVMSQFPSSLAVSAGEKVTMSCKSSQSLLNSRTRKSYLAWYQQKPGQFPKLLIYWAATR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4

Primary citation

Germline antibody recognition of distinct carbohydrate epitopes. Nguyen, H.P., Seto, N.O., MacKenzie, C.R. et al. Nat Struct Biol (2003) 10:1019-1025. DOI 10.1038/nsb1014 · PubMed

Other PDB entries of the same protein (UniProt I6L985 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1Q9W 1.75 Å, S45-18 Fab pentasaccharide bisphosphate complex
7TY0 3.5 Å, Nipah Virus attachment (G) glycoprotein ectodomain in complex with nAH1.3 neutralizing…

Browse structure collections

About this viewer

MolViewer shows 1Q9O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.