1QMA: Nuclear Transport Factor 2 (NTF2) W7A mutant

Name: PDB 1QMA: Nuclear Transport Factor 2 (NTF2) W7A mutant
Published: 2000-02-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transport

Nuclear Transport Factor 2 (NTF2) W7A mutant. Determined by X-ray diffraction at 2.5 Å resolution. Released 3 Feb 2000.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: RATTUS NORVEGICUS
Chains: 4
Atoms: 4,054
Mol. weight: 56.98 kDa
Released: 3 Feb 2000

Explore 1QMA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QMA contains 14 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-24	19
α-helix	26-32	7
β-strand	33-41	9	1
β-strand	44-47	4	1
α-helix	49-58	10
β-strand	64-75	12	1
β-strand	81-91	11	1
α-helix	95-96	2
β-strand	97-107	11	1
β-strand	112-121	10	1

Chains B and D: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	6-23	18
α-helix	30-32	3
β-strand	33-41	9	2
β-strand	44-47	4	2
α-helix	49-57	9
β-strand	64-75	12	2
β-strand	81-91	11	2
β-strand	97-108	12	2
β-strand	111-121	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear transport factor 2	A, B, C, D	protein	126	RATTUS NORVEGICUS	P61972 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1QMA_1 NUCLEAR TRANSPORT FACTOR 2 (chains A, B, C, D)
GDKPIAEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPF
QKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRL
ALHNFG

Primary citation

Interaction Betweeen Ntf2 and Xfxfg-Containing Nucleoporins is Required to Mediate Nuclear Import of Ran-Gdp. Bayliss, R., Ribbeck, K., Akin, D. et al. J Mol Biol (1999) 293:579. DOI 10.1006/JMBI.1999.3166 · PubMed

Other PDB entries of the same protein (UniProt P61972 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GY6 1.6 Å, NTF2 from rat, ammonium sulphate conditions
1JB2 2.0 Å, Crystal structure of NTF2 M84E mutant
1JB4 2.23 Å, Crystal structure of NTF2 M102E mutant
1AR0 2.3 Å, Nuclear transport factor 2 (NTF2) E42K mutant
1ASK 2.3 Å, Nuclear transport factor 2 (NTF2) H66A mutant
1JB5 2.3 Å, Crystal structure of NTF2 M118E mutant
1OUN 2.3 Å, Crystal structure of nuclear transport factor 2 (NTF2)
1U5O 2.5 Å, Structure of the D23A mutant of the nuclear transport carrier NTF2
5BXQ 2.5 Å, Structure of the NTF2:RanGDP complex

Browse structure collections

About this viewer

MolViewer shows 1QMA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.