Truncated human GROB[5-73], NMR, 20 structures. Determined by solution NMR. Released 4 Feb 2000.
Explore 1QNK in 3D Show helices and sheets RCSB PDB PDBe
1QNK contains 0 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 1 |
| β-strand | 23-29 | 7 | 1 |
| β-strand | 39-44 | 6 | 1 |
| β-strand | 49-52 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 15 | 1 | 1 |
| β-strand | 23-28 | 6 | 1 |
| β-strand | 40-44 | 5 | 1 |
| β-strand | 49-52 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-X-C motif chemokine 2 | A, B | protein | 69 | Homo sapiens | P19875 (AlphaFold model) |
>1QNK_1 C-X-C motif chemokine 2 (chains A, B) TELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIE KMLKNGKSN
Nuclear magnetic resonance solution structure of truncated human GRObeta [5-73] and its structural comparison with CXC chemokine family members GROalpha and IL-8. Qian, Y.Q., Johanson, K.O., McDevitt, P. J Mol Biol (1999) 294:1065-1072. DOI 10.1006/jmbi.1999.3333 · PubMed
Other PDB entries of the same protein (UniProt P19875 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QNK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.