1QNZ: 0.5B antibody

NMR structure of the 0.5b anti-HIV antibody complex with the gp120 V3 peptide. Determined by solution NMR. Released 3 Jun 2000.

Method: Solution NMR
Organisms: MUS MUSCULUS, HUMAN IMMUNODEFICIENCY VIRUS 1
Chains: 3
Atoms: 1,943
Mol. weight: 27.61 kDa
Released: 3 Jun 2000

Explore 1QNZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QNZ contains 4 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	115-119	5	1
β-strand	123-124	2	2
β-strand	128-137	10	1
β-strand	146-152	7	3
β-strand	158-164	7	3
β-strand	169-170	2	3
β-strand	180-185	6	1
β-strand	190-198	9	1
α-helix	200-202	3
β-strand	204-210	7	3
β-strand	220	1	3
β-strand	225-227	3	3
β-strand	228-229	2	2

Chain L: 2 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	4
β-strand	10-14	5	5
β-strand	19-21	3	6
β-strand	23-25	3	4
β-strand	30-31	2	7
β-strand	34-35	2	7
β-strand	37-42	6	5
β-strand	49-53	5	5
β-strand	57-58	2	5
β-strand	60	1	8
β-strand	62	1	8
β-strand	67-68	2	6
β-strand	71	1	4
β-strand	74	1	4
β-strand	77-79	3	6
α-helix	84-86	3
β-strand	89-94	6	5
α-helix	100	1
β-strand	101	1	5
β-strand	103	1	4
β-strand	106-111	6	5

Chain P: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	234-236	3	9
α-helix	239	1
β-strand	245-247	3	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
0.5B antibody (heavy chain)	H	protein	119	MUS MUSCULUS	P01750 (AlphaFold model)
0.5B antibody (light chain)	L	protein	112	MUS MUSCULUS	P01665 (AlphaFold model)
GP120	P	protein	18	HUMAN IMMUNODEFICIENCY VIRUS 1	Q79416

Sequence of entity 1 (H), FASTA

>1QNZ_1 0.5B ANTIBODY (HEAVY CHAIN) (chains H)
QVQLQQSGAELVKPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGNFHPYSDDTNY
NEKFKGKAKLTVEKSSSTVYLEFSRLTSDDSAVYYCAIHYGSAYAMDYWGQGTSVTVSS

Sequence of entity 2 (L), FASTA

>1QNZ_2 0.5B ANTIBODY (LIGHT CHAIN) (chains L)
DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYAASNLES
GIPARFSGSGSRTDFTLNIHPVEEEDAATYYCQQSNEDPFTFGSGTKLEIKR

Sequence of entity 3 (P), FASTA

>1QNZ_3 GP120 (chains P)
RKSIRIQRGPGRAFVTIG

Primary citation

NMR Structure of an Anti-Gp120 Antibody Complex with a V3 Peptide Reveals a Surface Important for Co-Receptor Binding. Tugarinov, V., Zvi, A., Levy, R. et al. Structure (2000) 8:385-395. DOI 10.1016/S0969-2126(00)00119-2 · PubMed

Other PDB entries of the same protein (UniProt P01750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QFW 3.5 Å, Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti…

Browse structure collections

About this viewer

MolViewer shows 1QNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.