NMR structure of the 0.5b anti-HIV antibody complex with the gp120 V3 peptide. Determined by solution NMR. Released 3 Jun 2000.
Explore 1QNZ in 3D Show helices and sheets RCSB PDB PDBe
1QNZ contains 4 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 115-119 | 5 | 1 |
| β-strand | 123-124 | 2 | 2 |
| β-strand | 128-137 | 10 | 1 |
| β-strand | 146-152 | 7 | 3 |
| β-strand | 158-164 | 7 | 3 |
| β-strand | 169-170 | 2 | 3 |
| β-strand | 180-185 | 6 | 1 |
| β-strand | 190-198 | 9 | 1 |
| α-helix | 200-202 | 3 | |
| β-strand | 204-210 | 7 | 3 |
| β-strand | 220 | 1 | 3 |
| β-strand | 225-227 | 3 | 3 |
| β-strand | 228-229 | 2 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 4 |
| β-strand | 10-14 | 5 | 5 |
| β-strand | 19-21 | 3 | 6 |
| β-strand | 23-25 | 3 | 4 |
| β-strand | 30-31 | 2 | 7 |
| β-strand | 34-35 | 2 | 7 |
| β-strand | 37-42 | 6 | 5 |
| β-strand | 49-53 | 5 | 5 |
| β-strand | 57-58 | 2 | 5 |
| β-strand | 60 | 1 | 8 |
| β-strand | 62 | 1 | 8 |
| β-strand | 67-68 | 2 | 6 |
| β-strand | 71 | 1 | 4 |
| β-strand | 74 | 1 | 4 |
| β-strand | 77-79 | 3 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 89-94 | 6 | 5 |
| α-helix | 100 | 1 | |
| β-strand | 101 | 1 | 5 |
| β-strand | 103 | 1 | 4 |
| β-strand | 106-111 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 234-236 | 3 | 9 |
| α-helix | 239 | 1 | |
| β-strand | 245-247 | 3 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 0.5B antibody (heavy chain) | H | protein | 119 | MUS MUSCULUS | P01750 (AlphaFold model) |
| 0.5B antibody (light chain) | L | protein | 112 | MUS MUSCULUS | P01665 (AlphaFold model) |
| GP120 | P | protein | 18 | HUMAN IMMUNODEFICIENCY VIRUS 1 | Q79416 |
>1QNZ_1 0.5B ANTIBODY (HEAVY CHAIN) (chains H) QVQLQQSGAELVKPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGNFHPYSDDTNY NEKFKGKAKLTVEKSSSTVYLEFSRLTSDDSAVYYCAIHYGSAYAMDYWGQGTSVTVSS
>1QNZ_2 0.5B ANTIBODY (LIGHT CHAIN) (chains L) DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYAASNLES GIPARFSGSGSRTDFTLNIHPVEEEDAATYYCQQSNEDPFTFGSGTKLEIKR
>1QNZ_3 GP120 (chains P) RKSIRIQRGPGRAFVTIG
NMR Structure of an Anti-Gp120 Antibody Complex with a V3 Peptide Reveals a Surface Important for Co-Receptor Binding. Tugarinov, V., Zvi, A., Levy, R. et al. Structure (2000) 8:385-395. DOI 10.1016/S0969-2126(00)00119-2 · PubMed
Other PDB entries of the same protein (UniProt P01750 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QNZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.