1QQD: Histocompatibility leukocyte antigen-CW4

Crystal structure of HLA-CW4, a ligand for the KIR2D natural killer cell inhibitory receptor. Determined by X-ray diffraction at 2.7 Å resolution. Released 8 Dec 1999.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,179
Mol. weight: 44.62 kDa
Released: 8 Dec 1999

Explore 1QQD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QQD contains 11 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	3-13	11	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	50-53	4
α-helix	57-84	28
β-strand	93-103	11	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-159	8
α-helix	160-164	5
α-helix	165-174	10
α-helix	176-179	4
α-helix	184-185	2
β-strand	186-193	8	2
β-strand	199-208	10	2
β-strand	214-219	6	3
β-strand	222-223	2	3
α-helix	225-227	3
β-strand	229-230	2	2
β-strand	234-235	2	2
β-strand	241-249	9	2
α-helix	254-256	3
β-strand	257-262	6	3
β-strand	270-272	3	3

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	4
β-strand	21-30	10	4
β-strand	36-41	6	5
β-strand	44-45	2	5
α-helix	46	1
β-strand	50-51	2	4
β-strand	55-56	2	4
β-strand	62-70	9	4
β-strand	78-83	6	5
β-strand	91-94	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histocompatibility leukocyte antigen (HLA)-CW4 (heavy chain)	A	protein	273	Homo sapiens	P10321 (AlphaFold model)
Beta-2 microglobulin	B	protein	99	Homo sapiens	P61769 (AlphaFold model)
HLA-CW4 specific peptide	C	protein	9

Sequence of entity 1 (A), FASTA

>1QQD_1 HISTOCOMPATIBILITY LEUKOCYTE ANTIGEN (HLA)-CW4 (HEAVY CHAIN) (chains A)
SHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWD
RETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGK
DYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQR
AEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTF
QKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW

Sequence of entity 2 (B), FASTA

>1QQD_2 BETA-2 MICROGLOBULIN (chains B)
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSGD
WSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD

Sequence of entity 3 (C), FASTA

>1QQD_3 HLA-CW4 SPECIFIC PEPTIDE (chains C)
QYDDAVYKL

Primary citation

Structure of human histocompatibility leukocyte antigen (HLA)-Cw4, a ligand for the KIR2D natural killer cell inhibitory receptor. Fan, Q.R., Wiley, D.C. J Exp Med (1999) 190:113-123. DOI 10.1084/jem.190.1.113 · PubMed

Other PDB entries of the same protein (UniProt P10321 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JTO 1.7 Å, Crystal structure of HLA-C05 in complex with a tumor mut10m peptide
5W6A 1.74 Å, HLA-C*06:02 presenting ARTELYRSL
4NT6 1.84 Å, HLA-C*0801 Crystal Structure
5W67 2.3 Å, HLA-C*06:02 presenting VRSRR(ABA)LRL
5VGD 2.32 Å, Crystal Structure of HLA-C*0501 in complex with SAE
3BZF 2.5 Å, The human non-classical major histocompatibility complex molecule HLA-E
6PAG 2.5 Å, Killer cell immunoglobulin-like receptor 2DL3 in complex with HLA-C*07:02
5VGE 2.6 Å, Crystal structure of HLA-C*07:02 in complex with RYR peptide
1IM9 2.8 Å, Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1 bound to…
5W69 2.8 Å, HLA-C*06:02 presenting ARFNDLRFV
1EFX 3.0 Å, Structure of a complex between the human natural killer cell receptor KIR2DL2 and a…
6PA1 3.01 Å, Killer cell immunoglobulin-like receptor 2DL2 in complex with HLA-C*07:02

Browse structure collections

About this viewer

MolViewer shows 1QQD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.