Crystal structure of tetrahymena GCN5 with bound acetyl-coenzyme a. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Sept 1999.
Explore 1QSR in 3D Show helices and sheets RCSB PDB PDBe
1QSR contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 50-54 | 5 | 1 |
| α-helix | 55 | 1 | |
| α-helix | 60-76 | 17 | |
| α-helix | 82-89 | 8 | |
| β-strand | 94-101 | 8 | 1 |
| β-strand | 105-115 | 11 | 1 |
| β-strand | 120-128 | 9 | 1 |
| α-helix | 130-132 | 3 | |
| α-helix | 137-151 | 15 | |
| β-strand | 156-161 | 6 | 1 |
| α-helix | 166-171 | 6 | |
| β-strand | 175 | 1 | 1 |
| α-helix | 182-185 | 4 | |
| β-strand | 186 | 1 | 2 |
| β-strand | 189 | 1 | 2 |
| β-strand | 196-201 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGCN5 histone acetyl transferase | A | protein | 162 | Tetrahymena thermophila | Q27198 (AlphaFold model) |
>1QSR_1 TGCN5 HISTONE ACETYL TRANSFERASE (chains A) LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIG GICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGY FKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
| ID | Name | Formula | Copies |
|---|---|---|---|
| ACO | Acetyl coenzyme *a | C23 H38 N7 O17 P3 S | 1 |
Structure of Tetrahymena GCN5 bound to coenzyme A and a histone H3 peptide. Rojas, J.R., Trievel, R.C., Zhou, J. et al. Nature (1999) 401:93-98. DOI 10.1038/43487 · PubMed
Other PDB entries of the same protein (UniProt Q27198 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1QSR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.