1QTP: Ap-2 clathrin adaptor alpha-appendage

Crystal structure of the ap-2 clathrin adaptor alpha-appendage. Determined by X-ray diffraction at 1.6 Å resolution. Released 12 Jul 1999.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Mus musculus
Chains: 1
Atoms: 2,223
Mol. weight: 28.02 kDa
Released: 12 Jul 1999

Explore 1QTP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QTP contains 8 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	705-708	4
β-strand	713-718	6	1
β-strand	722-731	10	1
β-strand	734-743	10	1
β-strand	749	1	2
β-strand	750-757	8	3
α-helix	760-765	6
β-strand	766-770	5	1
α-helix	771-774	4
β-strand	777	1	2
β-strand	782-791	10	1
β-strand	800-807	8	3
β-strand	810-817	8	3
α-helix	822-825	4
β-strand	826-828	3	4
α-helix	833-840	8
α-helix	846-848	3
β-strand	849-855	7	4
α-helix	862-872	11
β-strand	875-877	3	4
β-strand	887-894	8	4
β-strand	899-909	11	4
β-strand	914-921	8	4
α-helix	924-935	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ap-2 clathrin adaptor alpha subunit (alpha-adaptin C)	A	protein	247	Mus musculus	P17427 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1QTP_1 AP-2 CLATHRIN ADAPTOR ALPHA SUBUNIT (ALPHA-ADAPTIN C) (chains A)
GSPGIRLGSSEDNFARFVCKNNGVLFENQLLQIGLKSEFRQNLGRMFIFYGNKTSTQFLN
FTPTLICADDLQTNLNLQTKPVDPTVDGGAQVQQVVNIECISDFTEAPVLNIQFRYGGTF
QNVSVKLPITLNKFFQPTEMASQDFFQRWKQLSNPQQEVQNIFKAKHPMDTEITKAKIIG
FGSALLEEVDPNPANFVGAGIIHTKTTQIGCLLRLEPNLQAQMYRLTLRTSKDTVSQRLC
ELLSEQF

Primary citation

Crystal structure of the alpha appendage of AP-2 reveals a recruitment platform for clathrin-coat assembly. Traub, L.M., Downs, M.A., Westrich, J.L. et al. Proc Natl Acad Sci U S A (1999) 96:8907-8912. DOI 10.1073/pnas.96.16.8907 · PubMed

Other PDB entries of the same protein (UniProt P17427 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1KYF 1.22 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1QTS 1.4 Å, Crystal structure of the ap-2 clathrin adaptor alpha-appendage
7OHI 1.41 Å, FCHO1-peptide-AP2 alpha ear complex
2VJ0 1.6 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
1KYU 1.8 Å, Ap-2 clathrin adaptor alpha-appendage in complex with EPS15 dpf peptide
1B9K 1.9 Å, Alpha-adaptin appendage domain, from clathrin adaptor AP2
1W80 1.9 Å, Crystal structure of the alpha-adaptin appendage domain, from the AP2 adaptor complex,…
3HS8 1.9 Å, Intersectin 1-peptide-AP2 alpha ear complex
9PUE 1.91 Å, Structure of Alpha Appendage of AP2 bound to the FxDxF motif derived of CCDC32
1KY6 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
1KYD 2.0 Å, Ap-2 clathrin adaptor alpha-appendage in complex with epsin dpw peptide
9PPP 2.1 Å, Structure of Alpha Appendage of AP2 bound to the extended FxDxF motif derived of CCDC32

Browse structure collections

About this viewer

MolViewer shows 1QTP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.