1R29: B-cell lymphoma 6 protein

Crystal Structure of the B-Cell Lymphoma 6 (BCL6) BTB Domain to 1.3 Angstrom. Determined by X-ray diffraction at 1.3 Å resolution. Released 23 Dec 2003.

Method: X-ray diffraction
Resolution: 1.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,187
Mol. weight: 14.56 kDa
Released: 23 Dec 2003

Explore 1R29 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1R29 contains 7 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	14-27	14
β-strand	34-38	5	1
β-strand	41-45	5	1
α-helix	47-53	7
α-helix	55-61	7
β-strand	71-73	3	1
α-helix	80-92	13
α-helix	102-111	10
α-helix	115-126	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma 6 protein	A	protein	127	Homo sapiens	P41182 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1R29_1 B-cell lymphoma 6 protein (chains A)
GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFT
DQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCR
KFIKASE

Primary citation

Mechanism of SMRT corepressor recruitment by the BCL6 BTB domain. Ahmad, K.F., Melnick, A., Lax, S. et al. Mol Cell (2003) 12:1551-1564. DOI 10.1016/S1097-2765(03)00454-4 · PubMed

Other PDB entries of the same protein (UniProt P41182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWE 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7629
7RV1 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8826
7OKL 1.2 Å, Crystal structure of human BCL6 BTB domain in complex with compound 13e
7LWF 1.22 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9320
7RV4 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9153
7RV8 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-10268
7RUY 1.27 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8388
7RV2 1.29 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8828
7LWG 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-12694
7RUW 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7859
7RUX 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8311
7OKG 1.32 Å, Crystal structure of human BCL6 BTB domain in complex with compound 8e

Browse structure collections

About this viewer

MolViewer shows 1R29 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.