1R2B: BCL6 BTB domain

Crystal structure of the BCL6 BTB domain complexed with a SMRT co-repressor peptide. Determined by X-ray diffraction at 2.2 Å resolution. Released 23 Dec 2003.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,405
Mol. weight: 33.17 kDa
Released: 23 Dec 2003

Explore 1R2B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1R2B contains 14 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	1
α-helix	14-27	14
β-strand	34-38	5	2
β-strand	41-45	5	2
α-helix	47-53	7
α-helix	55-60	6
β-strand	71-73	3	2
α-helix	80-92	13
β-strand	94-97	4	3
α-helix	102-111	10
α-helix	115-127	13

Chain B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	3
α-helix	14-27	14
β-strand	34-38	5	4
β-strand	41-45	5	4
α-helix	47-53	7
α-helix	55-60	6
β-strand	71-73	3	4
α-helix	80-92	13
β-strand	94-98	5	1
α-helix	102-112	11
α-helix	115-125	11

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	1414-1415	2
β-strand	1416-1420	5	3
α-helix	1426-1429	4

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1416-1420	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma 6 protein	A, B	protein	127	Homo sapiens	P41182 (AlphaFold model)
Nuclear receptor co-repressor 2	C, D	protein	19	Homo sapiens	Q9Y618 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1R2B_1 B-cell lymphoma 6 protein (chains A, B)
GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFT
DQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDTCR
KFIKASE

Sequence of entity 2 (C, D), FASTA

>1R2B_2 Nuclear receptor co-repressor 2 (chains C, D)
GSLVATVKEAGRSIHEIPR

Primary citation

Mechanism of SMRT corepressor recruitment by the BCL6 BTB domain. Ahmad, K.F., Melnick, A., Lax, S. et al. Mol Cell (2003) 12:1551-1564. DOI 10.1016/S1097-2765(03)00454-4 · PubMed

Other PDB entries of the same protein (UniProt P41182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWE 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7629
7RV1 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8826
7OKL 1.2 Å, Crystal structure of human BCL6 BTB domain in complex with compound 13e
7LWF 1.22 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9320
7RV4 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9153
7RV8 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-10268
7RUY 1.27 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8388
7RV2 1.29 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8828
1R29 1.3 Å, Crystal Structure of the B-Cell Lymphoma 6 (BCL6) BTB Domain to 1.3 Angstrom
7LWG 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-12694
7RUW 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7859
7RUX 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8311

Browse structure collections

About this viewer

MolViewer shows 1R2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.