Solution structure of exoenzyme S. Determined by solution NMR. Released 12 Apr 2005.
Explore 1R4T in 3D Show helices and sheets RCSB PDB PDBe
1R4T contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 112-118 | 7 | |
| α-helix | 120-123 | 4 | |
| α-helix | 128-132 | 5 | |
| α-helix | 134-138 | 5 | |
| α-helix | 144-156 | 13 | |
| α-helix | 162-172 | 11 | |
| β-strand | 175-176 | 2 | 1 |
| β-strand | 179-180 | 2 | 1 |
| α-helix | 181-183 | 3 | |
| α-helix | 190-197 | 8 | |
| α-helix | 200-230 | 31 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| exoenzyme S | A | protein | 153 | Pseudomonas aeruginosa | Q93SQ1 (AlphaFold model) |
>1R4T_1 exoenzyme S (chains A) GSASSAVVFKQMVLQQALPMTLKGLDKASELATLTPEGLAREHSRLASGDGALRSLSTAL AGIRAGSQVEESRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDASPELRREITDQLHQ VMSEVALLRQAVESEVSRVSADYPYDVPDYASL
Solution structure of the N-terminal GTPase activating domain of Pseudomonas aeruginosa exoenzyme S. Langdon, G.M., Leitner, D., Labudde, D. et al. To be published.
Other PDB entries of the same protein (UniProt Q93SQ1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1R4T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.