Crystal structure of cytochrome P450-cam with a fluorescent probe D-8-ad (adamantane-1-carboxylic acid-5-dimethylamino-naphthalene-1-sulfonylamino-octyl-amide). Determined by X-ray diffraction at 1.45 Å resolution. Released 16 Nov 2004.
Explore 1RE9 in 3D Show helices and sheets RCSB PDB PDBe
1RE9 contains 29 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-5 | 4 | |
| α-helix | 10-12 | 3 | |
| β-strand | 13 | 1 | 1 |
| α-helix | 24-26 | 3 | |
| α-helix | 28-32 | 5 | |
| α-helix | 33-36 | 4 | |
| β-strand | 43-46 | 4 | 1 |
| α-helix | 48-50 | 3 | |
| β-strand | 52-55 | 4 | 1 |
| α-helix | 58-66 | 9 | |
| β-strand | 71-72 | 2 | 1 |
| α-helix | 80-85 | 6 | |
| α-helix | 97-109 | 13 | |
| α-helix | 111-132 | 22 | |
| α-helix | 133-135 | 3 | |
| β-strand | 137-139 | 3 | 2 |
| α-helix | 140 | 1 | |
| α-helix | 141-145 | 5 | |
| α-helix | 147-156 | 10 | |
| α-helix | 161-163 | 3 | |
| α-helix | 164-175 | 12 | |
| α-helix | 183-203 | 21 | |
| α-helix | 209-214 | 6 | |
| β-strand | 217-218 | 2 | 3 |
| β-strand | 221-222 | 2 | 3 |
| α-helix | 223-224 | 2 | |
| α-helix | 225-237 | 13 | |
| α-helix | 241-256 | 16 | |
| α-helix | 258-266 | 9 | |
| α-helix | 268-270 | 3 | |
| α-helix | 271-281 | 11 | |
| β-strand | 285 | 1 | 4 |
| β-strand | 288-291 | 4 | 1 |
| β-strand | 295-297 | 3 | 5 |
| β-strand | 300-302 | 3 | 5 |
| β-strand | 307-309 | 3 | 1 |
| α-helix | 312-315 | 4 | |
| α-helix | 343-345 | 3 | |
| α-helix | 350-367 | 18 | |
| β-strand | 372-373 | 2 | 2 |
| α-helix | 374 | 1 | |
| β-strand | 381-382 | 2 | 6 |
| β-strand | 386 | 1 | 4 |
| β-strand | 388-389 | 2 | 6 |
| β-strand | 393-395 | 3 | 2 |
| α-helix | 398-400 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome P450-cam | A | protein | 414 | Pseudomonas putida | P00183 (AlphaFold model) |
>1RE9_1 Cytochrome P450-cam (chains A) TTETIQSNANLAPLPPHVPEHLVFDFDMYNPSNLSAGVQEAWAVLQESNVPDLVWTRCNG GHWIATRGQLIREAYEDYRHFSSECPFIPREAGEAYDFIPTSMDPPEQRQFRALANQVVG MPVVDKLENRIQELACSLIESLRPQGQCNFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYL TDQMTRPDGSMTFAEAKEALYDYLIPIIEQRRQKPGTDAISIVANGQVNGRPITSDEAKR MCGLLLVGGLDTVVNFLSFSMEFLAKSPEHRQELIERPERIPAACEELLRRFSLVADGRI LTSDYEFHGVQLKKGDQILLPQMLSGLDERENACPMHVDFSRQKVSHTTFGHGSHLCLGQ HLARREIIVTLKEWLTRIPDFSIAPGAQIQHKSGIVSGVQALPLVWDPATTKAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 1 |
| DSO | Adamantane-1-carboxylic acid-5-dimethylamino-naphthalene-1-sulfonylamino-octyl-… | C31 H45 N3 O3 S | 1 |
Water and common crystallization additives (EDO, K) are not listed.
Conformational states of cytochrome P450cam revealed by trapping of synthetic molecular wires. Hays, A.M., Dunn, A.R., Chiu, R. et al. J Mol Biol (2004) 344:455-469. DOI 10.1016/j.jmb.2004.09.046 · PubMed
Other PDB entries of the same protein (UniProt P00183 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RE9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.