1RFS: Rieske soluble fragment from spinach

Rieske soluble fragment from spinach. Determined by X-ray diffraction at 1.83 Å resolution. Released 28 Jan 1998.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Spinacia oleracea
Chains: 1
Atoms: 1,110
Mol. weight: 14.81 kDa
Ligands: FES
Released: 28 Jan 1998

Explore 1RFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RFS contains 6 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	54	1	1
β-strand	56	1	1
β-strand	62	1	1
β-strand	64	1	1
α-helix	65-71	7
β-strand	77-81	5	1
α-helix	83-85	3
β-strand	87-91	5	1
β-strand	92	1	2
β-strand	98	1	2
β-strand	101-104	4	1
β-strand	106	1	3
α-helix	112	1
β-strand	113	1	3
α-helix	114-115	2
β-strand	116-117	2	4
β-strand	122-124	3	4
β-strand	131-133	3	4
β-strand	138-140	3	4
α-helix	146-148	3
β-strand	149-155	7	1
β-strand	158-163	6	1
α-helix	174-175	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rieske protein	A	protein	139	Spinacia oleracea	P08980 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RFS_1 RIESKE PROTEIN (chains A)
FVPPGGGAGTGGTIAKDALGNDVIAAEWLKTHAPGDRTLTQGLKGDPTYLVVESDKTLAT
FGINAVCTHLGCVVPFNAAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHCDVDDGKVV
FVPWTETDFRTGEAPWWSA

Ligands and cofactors

ID	Name	Formula	Copies
FES	FE2/S2 (inorganic) cluster	Fe2 S2	1

Primary citation

Biological identity and diversity in photosynthesis and respiration: structure of the lumen-side domain of the chloroplast Rieske protein. Carrell, C.J., Zhang, H., Cramer, W.A. et al. Structure (1997) 5:1613-1625. DOI 10.1016/S0969-2126(97)00309-2 · PubMed

Other PDB entries of the same protein (UniProt P08980 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9ES7 1.94 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f complex with water molecules at…
7ZYV 2.13 Å, Cryo-EM structure of catalytically active Spinacia oleracea cytochrome b6f in complex…
9ES8 2.24 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f with decylplastoquinone bound at…
9ES9 2.33 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f complex with inhibitor DBMIB bound…
7QRM 2.7 Å, Cryo-EM structure of catalytically active Spinacia oleracea cytochrome b6f in complex…
9TGG 3.18 Å, Cryo-EM structure of Spinacia oleracea cytochrome b6f complex with bound plastocyanin
6RQF 3.58 Å, 3.6 Angstrom cryo-EM structure of the dimeric cytochrome b6f complex from Spinacia…

Browse structure collections

About this viewer

MolViewer shows 1RFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.