1RGP: Gtpase-activation domain from rhogap

Gtpase-activation domain from rhogap. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Oct 1997.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,762
Mol. weight: 27.44 kDa
Released: 15 Oct 1997

Explore 1RGP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RGP contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	49-55	7
α-helix	64-76	13
α-helix	90-101	12
α-helix	104-106	3
α-helix	108-110	3
α-helix	115-126	12
α-helix	135-137	3
α-helix	138-142	5
α-helix	149-151	3
α-helix	152-160	9
α-helix	165-182	18
α-helix	185-188	4
α-helix	192-203	12
α-helix	217-228	12
α-helix	230-233	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rhogap	A	protein	242	Homo sapiens	Q07960 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RGP_1 RHOGAP (chains A)
HVKLEQLGIPRQVLKYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQE
PIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVI
LKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQ
ISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPS
GL

Primary citation

The structure of the GTPase-activating domain from p50rhoGAP. Barrett, T., Xiao, B., Dodson, E.J. et al. Nature (1997) 385:458-461. DOI 10.1038/385458a0 · PubMed

Other PDB entries of the same protein (UniProt Q07960 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TX4 1.65 Å, RHO/RHOGAP/GDP(DOT)ALF4 complex
6R3V 1.75 Å, Crystal Structure of RhoA-GDP-Pi in Complex with RhoGAP
1OW3 1.8 Å, Crystal Structure of RhoA.GDP.MgF3-in Complex with RhoGAP
2NGR 1.9 Å, Transition state complex for GTP hydrolysis by CDC42: comparisons of the high resolution…
7QSC 1.91 Å, Gtpase in complex with GDP.MGF3-
1GRN 2.1 Å, Crystal structure of the CDC42/CDC42GAP/ALF3 complex.
5M70 2.2 Å, Crystal Structure of human RhoGAP mutated in its arginin finger (R85A) in complex with…
7QTM 2.25 Å, Transition state analogue of small G protein in complex with relevant GAP
5M6X 2.4 Å, Crystal Structure of human RhoGAP mutated in its arginine finger (R85A) in complex with…
1AM4 2.7 Å, Complex between CDC42HS.GMPPNP and P50 rhogap (H. Sapiens)

Browse structure collections

About this viewer

MolViewer shows 1RGP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.