1RIE: Rieske iron-sulfur protein

Structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome BC1-complex. Determined by X-ray diffraction at 1.5 Å resolution. Released 7 Dec 1996.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Bos taurus
Chains: 1
Atoms: 1,169
Mol. weight: 14.62 kDa
Ligands: FES
Released: 7 Dec 1996

Explore 1RIE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RIE contains 6 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	74-77	4	1
α-helix	78-80	3
β-strand	86-91	6	2
β-strand	94-100	7	2
α-helix	103-110	8
α-helix	114-116	3
α-helix	123-125	3
β-strand	132-136	5	2
α-helix	145-146	2
β-strand	147-148	2	3
β-strand	154-158	5	3
β-strand	163-166	4	3
β-strand	171-173	3	3
α-helix	179-184	6
β-strand	185-187	3	1
β-strand	192-195	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rieske iron-sulfur protein	A	protein	129	Bos taurus	P13272 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RIE_1 RIESKE IRON-SULFUR PROTEIN (chains A)
VLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERV
KKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEF
TSDDMVIVG

Ligands and cofactors

ID	Name	Formula	Copies
FES	FE2/S2 (inorganic) cluster	Fe2 S2	1

Primary citation

Structure of a water soluble fragment of the 'Rieske' iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1 complex determined by MAD phasing at 1.5 A resolution. Iwata, S., Saynovits, M., Link, T.A. et al. Structure (1996) 4:567-579. DOI 10.1016/S0969-2126(96)00062-7 · PubMed

Other PDB entries of the same protein (UniProt P13272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PP9 2.1 Å, Bovine cytochrome bc1 complex with stigmatellin bound
1PPJ 2.1 Å, Bovine cytochrome bc1 complex with stigmatellin and antimycin
2A06 2.1 Å, Bovine cytochrome bc1 complex with stigmatellin bound
9W2X 2.2 Å, Cryo-EM structure of complex III on the bovine heart submitochondrial particles, III-1
2FYU 2.26 Å, Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
1L0L 2.35 Å, structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
1NTM 2.4 Å, Crystal Structure of Mitochondrial Cytochrome bc1 Complex at 2.4 Angstrom
9W2Y 2.4 Å, Cryo-EM structure of complex III on the bovine heart submitochondrial particles, III-2
1L0N 2.6 Å, native structure of bovine mitochondrial cytochrome bc1 complex
1NTK 2.6 Å, Crystal Structure of Mitochondrial Cytochrome bc1 in Complex with Antimycin A1
1NTZ 2.6 Å, Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone
1SQX 2.6 Å, Crystal Structure Analysis of Bovine Bc1 with Stigmatellin A

Browse structure collections

About this viewer

MolViewer shows 1RIE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.