Crystal structure of ribonuclease H from thermus thermophilus HB8 refined at 2.8 Å resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 31 Oct 1993.
Explore 1RIL in 3D Show helices and sheets RCSB PDB PDBe
1RIL contains 7 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-13 | 7 | 1 |
| β-strand | 18-26 | 9 | 1 |
| β-strand | 28 | 1 | 2 |
| β-strand | 31 | 1 | 2 |
| β-strand | 34-35 | 2 | 1 |
| β-strand | 38-42 | 5 | 1 |
| α-helix | 44-57 | 14 | |
| β-strand | 64-66 | 3 | 3 |
| β-strand | 67-68 | 2 | 1 |
| α-helix | 72-79 | 8 | |
| α-helix | 81-87 | 7 | |
| β-strand | 91 | 1 | 4 |
| β-strand | 97 | 1 | 4 |
| α-helix | 101-111 | 11 | |
| β-strand | 115-117 | 3 | 3 |
| α-helix | 118 | 1 | |
| α-helix | 123-125 | 3 | |
| α-helix | 129-141 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribonuclease H | A | protein | 166 | Thermus thermophilus | P29253 (AlphaFold model) |
>1RIL_1 RIBONUCLEASE H (chains A) MNPSPRKRVALFTDGACLGNPGPGGWAALLRFHAHEKLLSGGEACTTNNRMELKAAIEGL KALKEPCEVDLYTDSHYLKKAFTEGWLEGWRKRGWRTAEGKPVKNRDLWEALLLAMAPHR VRFHFVKGHTGHPENERVDREARRQAQSQAKTPCPPRAPTLFHEEA
Crystal structure of ribonuclease H from Thermus thermophilus HB8 refined at 2.8 A resolution. Ishikawa, K., Okumura, M., Katayanagi, K. et al. J Mol Biol (1993) 230:529-542. DOI 10.1006/jmbi.1993.1169 · PubMed
Other PDB entries of the same protein (UniProt P29253 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RIL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.