1RKG: Rat vitamin D receptor ligand binding domain

crystal structure of the rat vitamin D receptor ligand binding domain complexed with 2MbisP and a synthetic peptide containing the NR2 box of DRIP 205. Determined by X-ray diffraction at 1.9 Å resolution. Released 13 Apr 2004.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 2,156
Mol. weight: 34.9 kDa
Ligands: VD1
Released: 13 Apr 2004

Explore 1RKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RKG contains 16 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	126-142	17
α-helix	148-152	5
α-helix	154-156	3
α-helix	223-241	19
α-helix	247-249	3
α-helix	252-270	19
α-helix	271-273	3
β-strand	275-276	2	1
β-strand	281-283	3	1
α-helix	287-289	3
β-strand	290-291	2	1
α-helix	293-297	5
α-helix	303-318	16
α-helix	323-334	12
α-helix	345-366	22
α-helix	375-402	28
α-helix	404-407	4
α-helix	412-418	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	628-634	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vitamin D3 receptor	A	protein	292	Rattus norvegicus	P13053 (AlphaFold model)
Peroxisome proliferator-activated receptor binding protein	C	protein	13		Q15648 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RKG_1 Vitamin D3 receptor (chains A)
LKDSLRPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSVTLDLSPLSM
LPHLADLVSYSIQKVIGFAKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSW
DCGSQDYKYDVTDVSKAGHTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGV
QDAKLVEAIQDRLSNTLQTYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSF
QPENSMKLTPLVLEVFGNEISLVPRGSMAISDPNSSSVDKLAAALEHHHHHH

Sequence of entity 2 (C), FASTA

>1RKG_2 Peroxisome proliferator-activated receptor binding protein (chains C)
KNHPMLMNLLKDN

Ligands and cofactors

ID	Name	Formula	Copies
VD1	5-{2-[1-(1-methyl-propyl)-7A-methyl-octahydro-inden-4-ylidene]-ethylidene}-2-me…	C23 H36 O2	1

Primary citation

Molecular Structure of the Rat Vitamin D Receptor Ligand Binding Domain Complexed with 2-Carbon-Substituted Vitamin D(3) Hormone Analogues and a LXXLL-Containing Coactivator Peptide. Vanhooke, J.L., Benning, M.M., Bauer, C.B. et al. Biochemistry (2004) 43:4101-4110. DOI 10.1021/bi036056y · PubMed

Other PDB entries of the same protein (UniProt P13053 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9VOG 1.43 Å, Vitamin D receptor complex with a 5-{4-(m-carboran-1-yl)phenoxy}-4-hydroxypentanoic acid…
9M1D 1.44 Å, Vitamin D receptor complex with a methyldiphenylpropylsilane derivative
3VTC 1.5 Å, Crystal structure of rat vitamin D receptor bound to a partial agonist…
3VT7 1.65 Å, Crystal structures of rat VDR-LBD with W282R mutation
9M1C 1.67 Å, Vitamin D receptor complex with a triphenylpropylsilane derivative
9M13 1.68 Å, Vitamin D receptor complex with a dimethyldiphenylsilane derivative
2ZMI 1.7 Å, Crystal Structure of Rat Vitamin D Receptor Bound to Adamantyl Vitamin D Analogs:…
3VT3 1.7 Å, Crystal structures of rat VDR-LBD with R270L mutation
2O4J 1.74 Å, Crystal Structure of Rat Vitamin D Receptor Ligand Binding Domain Complexed with VitIII…
9VOL 1.75 Å, Vitamin D receptor complex with a 4-{4-(m-carboran-1-yl)-2-methylphenoxy}butanoic acid…
9M1B 1.77 Å, Vitamin D receptor complex with a diphenydipropylsilane derivative
9M1A 1.78 Å, Vitamin D receptor complex with a diethyldiphenylsilane derivative

Browse structure collections

About this viewer

MolViewer shows 1RKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.