Ribosomal protein S7 from thermus thermophilus. Determined by X-ray diffraction at 1.9 Å resolution. Released 11 Feb 1998.
Explore 1RSS in 3D Show helices and sheets RCSB PDB PDBe
1RSS contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-15 | 3 | |
| α-helix | 21-30 | 10 | |
| α-helix | 36-54 | 19 | |
| α-helix | 58-69 | 12 | |
| β-strand | 73-80 | 8 | 1 |
| β-strand | 83-90 | 8 | 1 |
| α-helix | 91-92 | 2 | |
| α-helix | 93-108 | 16 | |
| α-helix | 116-128 | 13 | |
| α-helix | 133-145 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ribosomal protein S7 | A | protein | 151 | Thermus thermophilus | P17291 (AlphaFold model) |
>1RSS_1 RIBOSOMAL PROTEIN S7 (chains A) MAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQA VENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELM DAAEGKGGAVKKKEDVERMAEANRAYAHYRW
The structure of ribosomal protein S7 at 1.9 A resolution reveals a beta-hairpin motif that binds double-stranded nucleic acids. Wimberly, B.T., White, S.W., Ramakrishnan, V. Structure (1997) 5:1187-1198. DOI 10.1016/S0969-2126(97)00269-4 · PubMed
Other PDB entries of the same protein (UniProt P17291 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1RSS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.