Crystal Structure (D) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 5.6 with a data set collected at SSRL beamline 11-1. Determined by X-ray diffraction at 1.88 Å resolution. Released 2 Mar 2004.
Explore 1RUL in 3D Show helices and sheets RCSB PDB PDBe
1RUL contains 18 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 7 |
| β-strand | 11-12 | 2 | 8 |
| β-strand | 18-25 | 8 | 7 |
| β-strand | 33-39 | 8 | 9 |
| β-strand | 45-52 | 8 | 9 |
| β-strand | 57-59 | 3 | 9 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 7 |
| β-strand | 77-82 | 6 | 7 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-96 | 9 | 9 |
| β-strand | 102-103 | 2 | 9 |
| β-strand | 107-109 | 3 | 9 |
| β-strand | 110-111 | 2 | 8 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 10 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 11 |
| α-helix | 125-127 | 3 | |
| α-helix | 128-130 | 3 | |
| β-strand | 137-147 | 11 | 11 |
| β-strand | 148 | 1 | 10 |
| β-strand | 153-157 | 4 | 12 |
| α-helix | 162-164 | 3 | |
| β-strand | 171-173 | 3 | 11 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-179 | 3 | 11 |
| β-strand | 184-194 | 11 | 11 |
| α-helix | 195-198 | 3 | |
| β-strand | 206-212 | 6 | 12 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-222 | 6 | 12 |
| α-helix | 223-227 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 27C | 1 | 3 |
| β-strand | 31 | 1 | 3 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-75 | 6 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 2 |
| α-helix | 96 | 1 | |
| β-strand | 97-98 | 2 | 2 |
| β-strand | 102-107 | 6 | 2 |
| β-strand | 111 | 1 | 4 |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-127 | 6 | |
| β-strand | 129-139 | 11 | 5 |
| β-strand | 140 | 1 | 4 |
| β-strand | 145-150 | 6 | 6 |
| β-strand | 153-155 | 3 | 6 |
| β-strand | 159-163 | 5 | 5 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 5 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 6 |
| β-strand | 205-210 | 6 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| immunoglobulin igg2a, light chain | L | protein | 219 | Mus musculus | Q8K0F8 |
| immunoglobulin igg2a, heavy chain | H | protein | 222 | Mus musculus | P01865 (AlphaFold model) |
>1RUL_1 immunoglobulin igg2a, light chain (chains L) DVVMTQSPKTISVTIGQPASISCKSSQRLLNSNGKTFLNWLLQRPGQSPKRLIYLGTKLD SGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPYTFGGGTKLEIKRADAAPTV SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>1RUL_2 immunoglobulin igg2a, heavy chain (chains H) RVQLQQSGPGLVKPSQSLSLTCTVTGYSITSDFAWNWIRQFPGNKLEWMGYINYSGFTSH NPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCAGLLWYDGGAGSWGQGTLVTVSAA KTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
| ID | Name | Formula | Copies |
|---|---|---|---|
| BEZ | Benzoic acid | C7 H6 O2 | 1 |
Water and common crystallization additives (GOL, ACT) are not listed.
Probing the antibody-catalyzed water-oxidation pathway at atomic resolution. Zhu, X., Wentworth Jr., P., Wentworth, A.D. et al. Proc Natl Acad Sci U S A (2004) 110:2247-2252. DOI 10.1073/pnas.0307311101 · PubMed
Other PDB entries of the same protein (UniProt Q8K0F8), best resolution first:
MolViewer shows 1RUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.