1RV6: PlGF

Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1. Determined by X-ray diffraction at 2.45 Å resolution. Released 20 Jan 2004.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,165
Mol. weight: 46.4 kDa
Ligands: B3P
Released: 20 Jan 2004

Explore 1RV6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RV6 contains 12 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain V: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	23	1	1
α-helix	25-32	8
β-strand	35-42	8	2
α-helix	43-46	4
β-strand	54-56	3	3
β-strand	59-66	8	2
β-strand	74-91	18	3
β-strand	98-114	17	3

Chain W: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	22	1
β-strand	23	1	3
α-helix	24	1
α-helix	25-32	8
β-strand	35-42	8	4
α-helix	43-46	4
α-helix	48-50	3
β-strand	54-56	3	1
β-strand	59-66	8	4
β-strand	74-91	18	1
β-strand	98-114	17	1

Chain X: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	135	1	5
α-helix	143	1
β-strand	144-147	4	6
β-strand	154-156	3	7
β-strand	160	1	5
β-strand	168-171	4	6
β-strand	175-177	3	6
β-strand	184-187	4	7
β-strand	191-194	4	7
α-helix	199-201	3
β-strand	203-211	9	6
β-strand	214-223	10	6

Chain Y: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	135	1	8
α-helix	138-139	2
α-helix	143	1
β-strand	144-147	4	9
β-strand	154-156	3	10
β-strand	160	1	8
β-strand	168-171	4	9
β-strand	175-177	3	9
β-strand	184-187	4	10
β-strand	191-194	4	10
α-helix	199-201	3
β-strand	204-210	7	9
β-strand	215-223	9	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
placenta growth factor (PlGF)	V, W	protein	101	Homo sapiens	P49763 (AlphaFold model)
FLT1 protein	X, Y	protein	100	Homo sapiens	P17948 (AlphaFold model)

Sequence of entity 1 (V, W), FASTA

>1RV6_1 placenta growth factor (PlGF) (chains V, W)
EVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVP
VETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKM

Sequence of entity 2 (X, Y), FASTA

>1RV6_2 FLT1 protein (chains X, Y)
DTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSR
KGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTI

Ligands and cofactors

ID	Name	Formula	Copies
B3P	2-[3-(2-hydroxy-1,1-dihydroxymethyl-ethylamino)-propylamino]-2-hydroxymethyl-pr…	C11 H26 N2 O6	1

Primary citation

The crystal structure of placental growth factor in complex with domain 2 of vascular endothelial growth factor receptor-1. Christinger, H.W., Fuh, G., de Vos, A.M. et al. J Biol Chem (2004) 279:10382-10388. DOI 10.1074/jbc.M313237200 · PubMed

Other PDB entries of the same protein (UniProt P49763 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FZV 2.0 Å, The crystal structure of human placenta growth factor-1 (plgf-1), an angiogenic protein…

Browse structure collections

About this viewer

MolViewer shows 1RV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.