Crystal Structure of Spinach Major Light-harvesting complex at 2.72 Angstrom Resolution. Determined by X-ray diffraction at 2.72 Å resolution. Released 30 Mar 2004.
Explore 1RWT in 3D Show helices and sheets RCSB PDB PDBe
1RWT contains 105 α-helices and 40 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-29 | 4 | |
| α-helix | 32-33 | 2 | |
| α-helix | 55-86 | 32 | |
| α-helix | 97-100 | 4 | |
| α-helix | 101-105 | 5 | |
| β-strand | 110 | 1 | 1 |
| α-helix | 112-114 | 3 | |
| β-strand | 121 | 1 | 1 |
| α-helix | 124-144 | 21 | |
| β-strand | 146 | 1 | 2 |
| β-strand | 149 | 1 | 2 |
| α-helix | 159-161 | 3 | |
| α-helix | 170-201 | 32 | |
| α-helix | 205-214 | 10 | |
| α-helix | 221-224 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-28 | 3 | |
| α-helix | 32-33 | 2 | |
| α-helix | 55-86 | 32 | |
| α-helix | 100-105 | 6 | |
| β-strand | 110 | 1 | 3 |
| α-helix | 112-114 | 3 | |
| β-strand | 121 | 1 | 3 |
| α-helix | 124-144 | 21 | |
| β-strand | 146 | 1 | 4 |
| β-strand | 149 | 1 | 4 |
| α-helix | 159-161 | 3 | |
| α-helix | 170-201 | 32 | |
| α-helix | 205-214 | 10 | |
| α-helix | 221-224 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-28 | 3 | |
| α-helix | 32-33 | 2 | |
| α-helix | 55-86 | 32 | |
| α-helix | 97-105 | 9 | |
| β-strand | 110 | 1 | 5 |
| α-helix | 112-114 | 3 | |
| β-strand | 121 | 1 | 5 |
| α-helix | 124-144 | 21 | |
| β-strand | 146 | 1 | 6 |
| β-strand | 149 | 1 | 6 |
| α-helix | 159-161 | 3 | |
| α-helix | 170-201 | 32 | |
| α-helix | 205-214 | 10 | |
| α-helix | 221-224 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-28 | 3 | |
| α-helix | 32-33 | 2 | |
| α-helix | 55-86 | 32 | |
| α-helix | 101-105 | 5 | |
| β-strand | 110 | 1 | 9 |
| α-helix | 112-114 | 3 | |
| β-strand | 121 | 1 | 9 |
| α-helix | 124-144 | 21 | |
| β-strand | 146 | 1 | 10 |
| β-strand | 149 | 1 | 10 |
| α-helix | 159-161 | 3 | |
| α-helix | 170-201 | 32 | |
| α-helix | 205-214 | 10 | |
| α-helix | 221-224 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-28 | 3 | |
| α-helix | 32-33 | 2 | |
| α-helix | 55-86 | 32 | |
| α-helix | 97-100 | 4 | |
| α-helix | 101-105 | 5 | |
| β-strand | 110 | 1 | 11 |
| α-helix | 112-114 | 3 | |
| β-strand | 121 | 1 | 11 |
| α-helix | 124-144 | 21 | |
| β-strand | 146 | 1 | 12 |
| β-strand | 149 | 1 | 12 |
| α-helix | 159-161 | 3 | |
| α-helix | 170-201 | 32 | |
| α-helix | 205-214 | 10 | |
| α-helix | 221-224 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-29 | 4 | |
| α-helix | 32-33 | 2 | |
| α-helix | 55-86 | 32 | |
| α-helix | 97-105 | 9 | |
| β-strand | 110 | 1 | 17 |
| α-helix | 112-114 | 3 | |
| β-strand | 121 | 1 | 17 |
| α-helix | 124-144 | 21 | |
| β-strand | 146 | 1 | 18 |
| β-strand | 149 | 1 | 18 |
| α-helix | 159-161 | 3 | |
| α-helix | 170-201 | 32 | |
| α-helix | 205-214 | 10 | |
| α-helix | 221-224 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chlorophyll A-B binding protein, chloroplast | A, B, C, D, E, F, G, H, I, J | protein | 232 | Spinacia oleracea | P12333 (AlphaFold model) |
>1RWT_1 Chlorophyll A-B binding protein, chloroplast (chains A, B, C, D, E, F, G, H, I, J) RKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAK NRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVH AQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CHL | Chlorophyll B | C55 H70 Mg N4 O6 | 60 |
| DGD | Digalactosyl diacyl glycerol (DGDG) | C51 H96 O15 | 10 |
| LHG | 1,2-dipalmitoyl-phosphatidyl-glycerole | C38 H75 O10 P | 10 |
| NEX | (1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-hydroxy-2,2,6-trimeth… | C40 H56 O4 | 10 |
| XAT | (3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-diepoxy-5,6,5',6'-… | C40 H56 O4 | 10 |
| LUT | (3R,3'R,6S)-4,5-didehydro-5,6-dihydro-beta,beta-carotene-3,3'-diol | C40 H56 O2 | 20 |
| BNG | nonyl beta-D-glucopyranoside | C15 H30 O6 | 10 |
| CLA | Chlorophyll a | C55 H72 Mg N4 O5 | 80 |
Water and common crystallization additives (NA) are not listed.
Crystal structure of spinach major light-harvesting complex at 2.72 A resolution. Liu, Z., Yan, H., Wang, K. et al. Nature (2004) 428:287-292. DOI 10.1038/nature02373 · PubMed
Other PDB entries of the same protein (UniProt P12333 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1RWT is part of these collections:
MolViewer shows 1RWT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.