1RYU: SWI1 ARID

Solution Structure of the SWI1 ARID. Determined by solution NMR. Released 25 May 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 953
Mol. weight: 13.59 kDa
Released: 25 May 2004

Explore 1RYU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1RYU contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	11-13	3
α-helix	19-34	16
α-helix	52-62	11
α-helix	67-69	3
α-helix	73-80	8
α-helix	88-100	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1	A	protein	120	Homo sapiens	O14497 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1RYU_1 SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1 (chains A)
SSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVK
EIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFA

Primary citation

Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition. Kim, S., Zhang, Z., Upchurch, S. et al. J Biol Chem (2004) 279:16670-16676. DOI 10.1074/jbc.M312115200 · PubMed

Other PDB entries of the same protein (UniProt O14497 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6LTH 3.0 Å, Structure of human BAF Base module
9RL4 3.5 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL-6
6LTJ 3.7 Å, Structure of nucleosome-bound human BAF complex
9RN2 4.1 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 2
9RMC 4.2 Å, Structure of BAF in complex with OCT4-SOX2-bound nucleosome - SHL+6 class 1
9RN1 5.9 Å, Structure of BAF-nucleosome complex with OCT4-SOX2 at SHL+6 in ADP-bound state, BAF47…
9A0K A structural model of the endogenoushuman SWI/SNF (BAF) complex bound to the nucleosome…

Browse structure collections

About this viewer

MolViewer shows 1RYU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.