1S0X: Human RORalpha ligand binding domain

Crystal structure of the human RORalpha ligand binding domain in complex with cholesterol sulfate at 2.2A. Determined by X-ray diffraction at 2.2 Å resolution. Released 10 Feb 2004.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,354
Mol. weight: 31.98 kDa
Ligands: C3S
Released: 10 Feb 2004

Explore 1S0X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1S0X contains 14 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	262-287	26
α-helix	292-297	6
β-strand	302	1	1
α-helix	303-304	2
α-helix	305-313	9
α-helix	316-339	24
α-helix	349-367	19
α-helix	368-371	4
β-strand	372-373	2	1
β-strand	378-381	4	1
β-strand	384-386	3	1
α-helix	388-394	7
α-helix	397-411	15
α-helix	417-428	12
α-helix	439-461	23
α-helix	467-494	28
α-helix	496-502	7
α-helix	505-510	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor ROR-alpha	A	protein	270	Homo sapiens	P35398 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1S0X_1 Nuclear receptor ROR-alpha (chains A)
GSSHHHHHHLEVLFQGPAELEHLAQNISKSHLETCQYLREELQQITWQTFLQEEIENYQN
KQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGSLEVVFIRMCRAFD
SQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEIALFSAFVLMSADR
SWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKA
IYPDIVRLHFPPLYKELFTSEFEPAMQIDG

Ligands and cofactors

ID	Name	Formula	Copies
C3S	Cholest-5-en-3-yl hydrogen sulfate	C27 H46 O4 S	1

Primary citation

Crystal structure of the human RORalpha Ligand binding domain in complex with cholesterol sulfate at 2.2 A. Kallen, J., Schlaeppi, J.M., Bitsch, F. et al. J Biol Chem (2004) 279:14033-14038. DOI 10.1074/jbc.M400302200 · PubMed

Other PDB entries of the same protein (UniProt P35398 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1N83 1.63 Å, Crystal Structure of the complex between the Orphan Nuclear Hormone Receptor…
4S15 1.9 Å, Crystal structure of the orphan nuclear receptor RORalpha ligand-binding domain in…

Browse structure collections

About this viewer

MolViewer shows 1S0X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.