Solution Structure of Mad1 SID-mSin3A PAH2 Complex. Determined by solution NMR. Released 6 Jul 2004.
Explore 1S5Q in 3D Show helices and sheets RCSB PDB PDBe
1S5Q contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-20 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 301-317 | 17 | |
| α-helix | 322-344 | 23 | |
| α-helix | 355-365 | 11 | |
| α-helix | 370-379 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| MAD protein | A | protein | 16 | Q05195 (AlphaFold model) | |
| Sin3a protein | B | protein | 89 | Mus musculus | Q60520 (AlphaFold model) |
>1S5Q_1 MAD protein (chains A) RMNIQMLLEAADYLER
>1S5Q_2 Sin3a protein (chains B) SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALT EQEVYAQVARLFKNQEDLLSEFGQFLPDA
HBP1 and Mad1 repressors bind the Sin3 corepressor PAH2 domain with opposite helical orientations. Swanson, K.A., Knoepfler, P.S., Huang, K. et al. Nat Struct Mol Biol (2004) 11:738-746. DOI 10.1038/nsmb798 · PubMed
Other PDB entries of the same protein (UniProt Q05195 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1S5Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.