1S62: Escherichia coli TolA C-terminal domain

Solution structure of the Escherichia coli TolA C-terminal domain. Determined by solution NMR. Released 15 Feb 2005.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 757
Mol. weight: 11.33 kDa
Released: 15 Feb 2005

Explore 1S62 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1S62 contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	14-28	15
β-strand	43	1	1
β-strand	44-49	6	2
β-strand	53-59	7	2
α-helix	64-75	12
α-helix	85-91	7
β-strand	97	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TolA protein	A	protein	106	Escherichia coli	P19934 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1S62_1 TolA protein (chains A)
AEFGNTKNNGASGADINNYAGQIKSAIESKFYDASSYAGKTCTLRIKLAPDGMLLDIKPE
GGDPALCQAALAAAKLAKIPKPPSQAVYEVFKNAPLDFKPHHHHHH

Primary citation

Solution structure of the E.coli TolA C-terminal domain reveals conformational changes upon binding to the phage g3p N-terminal domain. Deprez, C., Lloubes, R., Gavioli, M. et al. J Mol Biol (2005) 346:1047-1057. DOI 10.1016/j.jmb.2004.12.028 · PubMed

Other PDB entries of the same protein (UniProt P19934 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1TOL 1.85 Å, Fusion of N-terminal domain of the minor coat protein from gene III in phage M13, and…
3QDP 2.15 Å, Structural characterization of the interaction of colicin A, colicin N, and TolB with…
3QDR 2.65 Å, Structural characterization of the interaction of colicin A, colicin N, and TolB with…
9DDM 2.94 Å, E. coli TolAQR conformation I
9DDN 3.18 Å, E. coli TolAQR conformation II
9KPZ 3.18 Å, Structure of TolQRA complex at pH 5.4 from E.coli
9QUQ 3.28 Å, cryo-EM structure of TolQR conformation2 in SMA nanodiscs
9QVD 3.52 Å, cryo-EM structure of TolQRA in nanodiscs
9K49 3.6 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…
9KQ0 3.6 Å, Structure of TolQRA complex at pH 8.0 from E.coli
9KCH 4.19 Å, Cryo-EM structure of inner membrane TolQRA complex in CYMAL-6-Neopentyl Glycol detergent…

Browse structure collections

About this viewer

MolViewer shows 1S62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.