Crystal structure of the SH3 domain from a S. cerevisiae hypothetical 40.4 kDa protein in complex with a peptide. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 Apr 2005.
Explore 1SSH in 3D Show helices and sheets RCSB PDB PDBe
1SSH contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-8 | 4 | 1 |
| β-strand | 12 | 1 | 2 |
| β-strand | 19 | 1 | 1 |
| β-strand | 22 | 1 | 2 |
| β-strand | 27-32 | 6 | 1 |
| β-strand | 40-45 | 6 | 1 |
| β-strand | 48-53 | 6 | 1 |
| α-helix | 54-56 | 3 | |
| β-strand | 57-59 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-11 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region | A | protein | 60 | Saccharomyces cerevisiae | P43603 (AlphaFold model) |
| 12-mer peptide from Cytoskeleton assembly control protein SLA1 | B | protein | 12 | P32790 (AlphaFold model) |
>1SSH_1 Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region (chains A) GSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV
>1SSH_2 12-mer peptide from Cytoskeleton assembly control protein SLA1 (chains B) EGPPPAMPARPT
Yeast SH3 domain structural genomics. Kursula, P., Kursula, I., Lehmann, F. et al. To be published.
Other PDB entries of the same protein (UniProt P43603 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SSH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.