1SUH: Epithelial cadherin

Amino-terminal domain of epithelial cadherin in the calcium bound state, NMR, 20 structures. Determined by solution NMR. Released 11 Jul 1996.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 821
Mol. weight: 16.15 kDa
Released: 11 Jul 1996

Explore 1SUH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SUH contains 1 α-helix and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	1
β-strand	11	1	2
β-strand	19-23	5	3
α-helix	28-30	3
β-strand	34-39	6	1
β-strand	41	1	4
β-strand	45	1	4
β-strand	51-53	3	3
β-strand	59-62	4	3
β-strand	66	1	2
β-strand	73-82	10	1
β-strand	87	1	1
β-strand	92-99	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epithelial cadherin	A	protein	146	Mus musculus	P09803 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SUH_1 EPITHELIAL CADHERIN (chains A)
MRDWVIPPISCPENEKGEFPKNLVQIKSNRDKETKVFYSITGQGADKPPVGVFIIERETG
WLKVTQPLDREAIAKYILYSHAVSSNGEAVEDPMEIVITVTDQNDNRPEFTQEVFEGSVA
EGAVPGTSVMKVSATDADDDVNTYNA

Primary citation

1H, 15N and 13C resonance assignments and monomeric structure of the amino-terminal extracellular domain of epithelial cadherin. Overduin, M., Tong, K.I., Kay, C.M. et al. J Biomol NMR (1996) 7:173-189. DOI 10.1007/BF00202035 · PubMed

Other PDB entries of the same protein (UniProt P09803 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3QRB 1.8 Å, crystal structure of E-cadherin EC1-2 P5A P6A
2OMW 1.85 Å, Crystal structure of InlA S192N Y369S/mEC1 complex
1EDH 2.0 Å, E-cadherin domains 1 and 2 in complex with calcium
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
3LNE 2.0 Å, Crystal structure of E-cadherin EC12 K14E
3LNI 2.3 Å, Crystal structure of E-cadherin EC12 E89A
2QVF 2.4 Å, mouse E-cadherin domains 1,2
4QD2 2.4 Å, Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
3LNF 2.5 Å, Crystal structure of E-cadherin EC12 K14EW2A
3LNH 2.6 Å, Crystal structure of E-cadherin EC12 W2A
7AR4 2.6 Å, Crystal structure of beta-catenin in complex with cyclic peptide inhibitor
3LNG 2.7 Å, Crystal structure of E-cadherin EC12 AA extension

Browse structure collections

About this viewer

MolViewer shows 1SUH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.