Triosephosphate isomerase from Gallus gallus, loop 6 hinge mutant K174L, T175W. Determined by X-ray diffraction at 1.71 Å resolution. Released 24 Aug 2004.
Explore 1SW0 in 3D Show helices and sheets RCSB PDB PDBe
1SW0 contains 32 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-5 | 3 | |
| β-strand | 6-11 | 6 | 1 |
| β-strand | 14 | 1 | 2 |
| α-helix | 18-30 | 13 | |
| β-strand | 37-42 | 6 | 1 |
| α-helix | 45-47 | 3 | |
| α-helix | 48-54 | 7 | |
| β-strand | 60-63 | 4 | 1 |
| β-strand | 72 | 1 | 3 |
| α-helix | 80-85 | 6 | |
| β-strand | 90-93 | 4 | 1 |
| α-helix | 96-100 | 5 | |
| α-helix | 106-118 | 13 | |
| β-strand | 122-127 | 6 | 1 |
| α-helix | 131-135 | 5 | |
| α-helix | 139-151 | 13 | |
| α-helix | 157-159 | 3 | |
| β-strand | 160-164 | 5 | 1 |
| α-helix | 167-169 | 3 | |
| α-helix | 178-195 | 18 | |
| α-helix | 198-203 | 6 | |
| β-strand | 206-209 | 4 | 1 |
| α-helix | 217-221 | 5 | |
| β-strand | 228-231 | 4 | 1 |
| α-helix | 233-236 | 4 | |
| α-helix | 240-244 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-5 | 2 | |
| β-strand | 6-11 | 6 | 4 |
| β-strand | 14 | 1 | 3 |
| α-helix | 18-30 | 13 | |
| β-strand | 37-43 | 7 | 4 |
| α-helix | 45-47 | 3 | |
| α-helix | 48-54 | 7 | |
| β-strand | 59-63 | 5 | 4 |
| β-strand | 72 | 1 | 2 |
| α-helix | 80-85 | 6 | |
| β-strand | 90-93 | 4 | 4 |
| α-helix | 96-100 | 5 | |
| α-helix | 106-118 | 13 | |
| β-strand | 122-127 | 6 | 4 |
| α-helix | 131-136 | 6 | |
| α-helix | 139-151 | 13 | |
| α-helix | 157-159 | 3 | |
| β-strand | 160-164 | 5 | 4 |
| α-helix | 167-169 | 3 | |
| α-helix | 178-195 | 18 | |
| α-helix | 198-203 | 6 | |
| β-strand | 206-209 | 4 | 4 |
| α-helix | 217-221 | 5 | |
| β-strand | 228-231 | 4 | 4 |
| α-helix | 233-236 | 4 | |
| α-helix | 240-244 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Triosephosphate isomerase | A, B | protein | 248 | Gallus gallus | P00940 (AlphaFold model) |
>1SW0_1 Triosephosphate isomerase (chains A, B) MAPRKFFVGGNWKMNGDKKSLGELIHTLNGAKLSADTEVVCGAPSIYLDFARQKLDAKIG VAAQNCYKVPKGAFTGEISPAMIKDIGAAWVILGHSERRHVFGESDELIGQKVAHALAEG LGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGLWATPQQ AQEVHEKLRGWLKSHVSDAVAQSTRIIYGGSVTGGNCKELASQHDVDGFLVGGASLKPEF VDIINAKH
| ID | Name | Formula | Copies |
|---|---|---|---|
| PGA | 2-phosphoglycolic acid | C2 H5 O6 P | 2 |
Understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase. Kursula, I., Salin, M., Sun, J. et al. Protein Eng Des Sel (2004) 17:375-382. DOI 10.1093/protein/gzh048 · PubMed
Other PDB entries of the same protein (UniProt P00940 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1SW0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.