1SW6: S. Cerevisiae SWI6 ankyrin-repeat fragment

S. Cerevisiae SWI6 ankyrin-repeat fragment. Determined by X-ray diffraction at 2.1 Å resolution. Released 15 Sept 1999.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 4,155
Mol. weight: 72.24 kDa
Released: 15 Sept 1999

Explore 1SW6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SW6 contains 37 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	214-216	3	1
α-helix	230	1
β-strand	233-234	2	2
α-helix	235	1
β-strand	236	1	3
α-helix	237-239	3
α-helix	244-258	15
α-helix	292-302	11
α-helix	321-327	7
α-helix	331-339	9
β-strand	346	1	3
α-helix	354-360	7
α-helix	363-366	4
α-helix	370-377	8
α-helix	378-382	5
β-strand	383-384	2	2
α-helix	391-399	9
α-helix	405-421	17
α-helix	422-424	3
β-strand	427-429	3	1
α-helix	448-452	5
α-helix	455-458	4
α-helix	459-463	5
α-helix	473-480	8
α-helix	483-491	9
α-helix	506-509	4

Chain B: 17 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	214-216	3	4
β-strand	233-234	2	5
α-helix	235	1
β-strand	236	1	6
α-helix	237-239	3
α-helix	244-257	14
α-helix	292-302	11
α-helix	321-327	7
α-helix	331-339	9
β-strand	346	1	6
α-helix	354-360	7
α-helix	367-377	11
α-helix	378-382	5
β-strand	383-384	2	5
α-helix	391-401	11
α-helix	408-421	14
α-helix	422-424	3
β-strand	427-429	3	4
α-helix	448-452	5
α-helix	455-461	7
α-helix	473-480	8
α-helix	483-492	10
α-helix	506-509	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Regulatory protein SWI6	A, B	protein	327	Saccharomyces cerevisiae	P09959 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1SW6_1 REGULATORY PROTEIN SWI6 (chains A, B)
NDDINKGPSGDNENNGTDDNDRTAGPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQK
MKLEAFLQRLLFPEIQEMPTSLNNDSSNRNSEGGSSNQQQQHVSFDSLLQEVNDAFPNTQ
LNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVNNYDS
GTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIVKKQNRPI
QSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVD
ALLDYGADPFIANKSGLRPVDFGAGLE

Primary citation

X-ray structural analysis of the yeast cell cycle regulator Swi6 reveals variations of the ankyrin fold and has implications for Swi6 function. Foord, R., Taylor, I.A., Sedgwick, S.G. et al. Nat Struct Biol (1999) 6:157-165. DOI 10.1038/5845 · PubMed

Other PDB entries of the same protein (UniProt P09959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XW5 1.85 Å, Crystal structure of budding yeast Cdc14p (C283S) bound to a Swi6p phosphopeptide
2XFV 1.9 Å, Structure of the amino-terminal domain from the cell-cycle regulator Swi6

Browse structure collections

About this viewer

MolViewer shows 1SW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.