1SY6: CD3gammaepsilon Heterodimer

Crystal Structure of CD3gammaepsilon Heterodimer in Complex with OKT3 Fab Fragment. Determined by X-ray diffraction at 2.1 Å resolution. Released 25 May 2004.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 4,651
Mol. weight: 70.16 kDa
Released: 25 May 2004

Explore 1SY6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SY6 contains 27 α-helices and 59 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	11
β-strand	19-24	6	11
β-strand	30-35	6	12
β-strand	38-44	7	12
β-strand	50-54	5	11
α-helix	55-57	3
β-strand	60-66	7	12
α-helix	71-74	4
β-strand	75-80	6	12
α-helix	119-121	3
β-strand	122-126	5	13
β-strand	129-133	5	13
β-strand	142-146	5	12
β-strand	149-151	3	12
β-strand	160-163	4	13
β-strand	166-169	4	13
α-helix	174-177	4
β-strand	179-185	7	12
α-helix	190-192	3
β-strand	196-201	6	12

Chain H: 12 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
β-strand	18-25	8	6
α-helix	29-31	3
β-strand	34-39	6	7
β-strand	46-52	7	7
β-strand	57-60	4	7
α-helix	62-64	3
β-strand	65	1	6
β-strand	68-73	6	6
α-helix	74-76	3
β-strand	78-83	6	6
α-helix	88-90	3
β-strand	92-100	9	7
α-helix	101-103	3
β-strand	105-109	5	7
β-strand	113-117	5	7
α-helix	120-122	3
β-strand	123	1	8
α-helix	124-125	2
β-strand	126-130	5	9
α-helix	131-133	3
β-strand	141-151	11	9
β-strand	152	1	8
β-strand	157-160	4	10
α-helix	161-163	3
β-strand	165	1	10
β-strand	169-171	3	9
α-helix	172-174	3
β-strand	175-176	2	9
β-strand	181-190	10	9
β-strand	200-205	6	10
α-helix	206-208	3
β-strand	210-215	6	10

Chain L: 10 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
α-helix	17	1
β-strand	18-25	8	1
β-strand	33-37	5	2
β-strand	44-48	5	2
β-strand	52-53	2	2
α-helix	54	1
β-strand	61-66	6	1
β-strand	69-75	7	1
α-helix	79-81	3
β-strand	83-89	7	2
α-helix	95	1
β-strand	96-97	2	2
β-strand	101-105	5	2
α-helix	106	1
β-strand	110	1	3
α-helix	111-112	2
β-strand	113-117	5	4
α-helix	118-120	3
α-helix	121-125	5
β-strand	128-138	11	4
β-strand	139	1	3
β-strand	144-149	6	5
β-strand	152-154	3	5
β-strand	158-162	5	4
α-helix	163-166	4
β-strand	172-181	10	4
α-helix	182-186	5
β-strand	190-196	7	5
β-strand	204-209	6	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
OKT3 Fab light chain	L	protein	213	Mus musculus	Q5XFY8 (AlphaFold model)
OKT3 Fab heavy chain	H	protein	219	Mus musculus	P01865 (AlphaFold model)
T-cell surface glycoprotein CD3 gamma/epsilon chain	A	protein	204	Homo sapiens	P07766 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1SY6_1 OKT3 Fab light chain (chains L)
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH
FRGSGSGTSYSLTISGMEAEDAATYYCQQWSSNPFTFGSGTKLEINRADTAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (H), FASTA

>1SY6_2 OKT3 Fab heavy chain (chains H)
QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY
NQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA
KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL
YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR

Sequence of entity 3 (A), FASTA

>1SY6_3 T-cell surface glycoprotein CD3 gamma/epsilon chain (chains A)
MQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDP
RGMYQCKGSQNKSKPLQVYYRMGSADDAKKDAAKKDDAKKDDAKKDGSDGNEEMGGITQT
PYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSG
YYVCYPRGSKPEDANFYLYLRARV

Primary citation

Crystal structure of the human T cell receptor CD3(epsilon)(gamma) heterodimer complexed to the therapeutic mAb OKT3. Kjer-Nielsen, L., Dunstone, M.A., Kostenko, L. et al. Proc Natl Acad Sci U S A (2004) 101:7675-7680. DOI 10.1073/pnas.0402295101 · PubMed

Other PDB entries of the same protein (UniProt Q5XFY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J4W 2.5 Å, Structure of a Plasmodium vivax apical membrane antigen 1-Fab F8.12.19 complex
2J5L 2.9 Å, Structure of a Plasmodium falciparum apical membrane antigen 1-Fab F8. 12.19 complex

Browse structure collections

About this viewer

MolViewer shows 1SY6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.