1T0P: Integrin alpha-L

Structural Basis of ICAM recognition by integrin alpahLbeta2 revealed in the complex structure of binding domains of ICAM-3 and alphaLbeta2 at 1.65 A. Determined by X-ray diffraction at 1.66 Å resolution. Released 8 Mar 2005.

Method: X-ray diffraction
Resolution: 1.66 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,219
Mol. weight: 29.4 kDa
Ligands: NAG, MG
Released: 8 Mar 2005

Explore 1T0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T0P contains 10 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	130-137	8	1
β-strand	139	1	2
α-helix	144-160	17
β-strand	166-173	8	1
β-strand	177-181	5	1
α-helix	183-189	7
α-helix	192-196	5
β-strand	204	1	2
α-helix	208-214	7
α-helix	215-219	5
α-helix	222-224	3
β-strand	231-238	8	1
α-helix	249-251	3
β-strand	255-260	6	1
α-helix	268-274	7
α-helix	282-285	4
β-strand	286-288	3	1
α-helix	293-298	6

Chain B: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	3
β-strand	13-14	2	4
β-strand	19-26	8	3
β-strand	32-37	6	5
β-strand	41-48	8	3
β-strand	51-57	7	3
β-strand	63-71	9	5
β-strand	74-82	9	5
β-strand	83-84	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-L	A	protein	175	Homo sapiens	P20701 (AlphaFold model)
Intercellular adhesion molecule-3	B	protein	86	Homo sapiens	P32942 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T0P_1 Integrin alpha-L (chains A)
MGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDY
VKWKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSG
NIDAAKDIIRYIIGIGKHFQTKESQETLHKFASKPASEFVCILDTFECLKDLFTE

Sequence of entity 2 (B), FASTA

>1T0P_2 Intercellular adhesion molecule-3 (chains B)
QEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVT
GNSRILCSVYCNGSQITGSSNITVYG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2
MG	Magnesium ion	Mg	1

Primary citation

An atomic resolution view of ICAM recognition in a complex between the binding domains of ICAM-3 and integrin alphaLbeta2. Song, G., Yang, Y., Liu, J.H. et al. Proc Natl Acad Sci U S A (2005) 102:3366-3371. DOI 10.1073/pnas.0500200102 · PubMed

Other PDB entries of the same protein (UniProt P20701 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MJN 1.3 Å, Crystal Structure of the intermediate affinity aL I domain mutant
2ICA 1.56 Å, CD11a (LFA1) I-domain complexed with BMS-587101 aka 5-[(5S,…
3F78 1.6 Å, Crystal structure of wild type LFA1 I domain complexed with isoflurane
3F74 1.7 Å, Crystal structure of wild type LFA1 I domain
2O7N 1.75 Å, CD11A (LFA1) I-domain complexed with 7A-[(4-cyanophenyl)methyl]-6-(3,5-dichlorophenyl)-5-…
1LFA 1.8 Å, CD11A I-domain with bound MN++
1XUO 1.8 Å, X-ray structure of LFA-1 I-domain bound to a 1,4-diazepane-2,5-dione inhibitor at 1.8A…
3BQN 1.8 Å, LFA-1 I domain bound to inhibitors
4IXD 1.8 Å, X-ray structure of lfa-1 i-domain in complex with ibe-667 at 1.8a resolution
7KC3 1.8 Å, X-ray structure of Lfa-1 I domain collected at 273 K
3M6F 1.85 Å, CD11A I-domain complexed with 6-((5S,9R)-9-(4-CYANOPHENYL)-3-(3,5-DICHLOROPHENYL)-1-METHY…
7KC6 1.85 Å, X-ray structure of Lfa-1 I domain in complex with Lovastatin collected at 273 K

Browse structure collections

About this viewer

MolViewer shows 1T0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.