1T2M: Pdz Domain Of AF-6

Solution Structure Of The Pdz Domain Of AF-6. Determined by solution NMR. Released 8 Feb 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 666
Mol. weight: 10.64 kDa
Released: 8 Feb 2005

Explore 1T2M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T2M contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
β-strand	19-24	6	1
β-strand	33-39	7	1
α-helix	44-48	5
β-strand	55-60	6	1
β-strand	63-64	2	1
α-helix	70-78	9
β-strand	83-90	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AF-6 protein	A	protein	101	Homo sapiens	P55196 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T2M_1 AF-6 protein (chains A)
MKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSV
DGRSLVGLSQERAAELMTRTSSVVTLEVAKQGALEHHHHHH

Primary citation

Solution Structure of AF-6 PDZ Domain and Its Interaction with the C-terminal Peptides from Neurexin and Bcr. Zhou, H., Xu, Y., Yang, Y. et al. J Biol Chem (2005) 280:13841-13847. DOI 10.1074/jbc.M411065200 · PubMed

Other PDB entries of the same protein (UniProt P55196 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QCR 2.28 Å, MLLT4/Afadin PDZ domain in complex with the C-terminal peptide from protein E of…
5A6C 2.9 Å, Concomitant binding of Afadin to LGN and F-actin directs planar spindle orientation
1XZ9 Structure of AF-6 PDZ domain
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…
2EXG Making Protein-Protein Interactions Drugable: Discovery of Low-Molecular-Weight Ligands…

Browse structure collections

About this viewer

MolViewer shows 1T2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.