1T3G: PDB entry 1T3G

Crystal structure of the Toll/interleukin-1 receptor (TIR) domain of human IL-1RAPL. Determined by X-ray diffraction at 2.3 Å resolution. Released 8 Feb 2005.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,725
Mol. weight: 38.45 kDa
Released: 8 Feb 2005

Explore 1T3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T3G contains 24 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	405	1	1
β-strand	407-410	4	2
α-helix	426-428	3
α-helix	429-433	5
α-helix	434-436	3
α-helix	437-441	5
β-strand	446-447	2	2
α-helix	449-452	4
α-helix	459-468	10
β-strand	470	1	1
β-strand	472-477	6	2
α-helix	479-483	5
α-helix	488-492	5
α-helix	494-501	8
β-strand	506-511	6	2
α-helix	518-529	12
β-strand	534-538	5	2
α-helix	542-545	4
α-helix	550-558	9

Chain B: 12 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	405	1	3
β-strand	407-410	4	4
α-helix	425-428	4
α-helix	429-433	5
α-helix	434-436	3
α-helix	437-441	5
β-strand	446-447	2	4
α-helix	449-452	4
α-helix	459-468	10
β-strand	470	1	3
β-strand	473-477	5	4
α-helix	479-484	6
α-helix	488-492	5
α-helix	494-502	9
β-strand	507-511	5	4
α-helix	518-528	11
β-strand	534-538	5	4
α-helix	542-545	4
α-helix	550-558	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
X-linked interleukin-1 receptor accessory protein-like 1	A, B	protein	159	Homo sapiens	Q9NZN1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1T3G_1 X-linked interleukin-1 receptor accessory protein-like 1 (chains A, B)
KDYDAYLSYTKVDPDQWNQETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIED
VARCVDQSKRLIIVMTPNYVVRRGWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQ
EVEALKHTIKLLTVIKWHGPKCNKLNSKFWKRLQYEMPF

Primary citation

Crystal structure of the Toll/interleukin-1 receptor domain of human IL-1RAPL. Khan, J.A., Brint, E.K., O'Neill, L.A.J. et al. J Biol Chem (2004) 279:31664-31670. DOI 10.1074/jbc.M403434200 · PubMed

Other PDB entries of the same protein (UniProt Q9NZN1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4M92 1.6 Å, Crystal structure of hN33/Tusc3-peptide 2
5WY8 3.07 Å, Crystal structure of PTP delta Ig1-Ig3 in complex with IL1RAPL1 Ig1-Ig3

Browse structure collections

About this viewer

MolViewer shows 1T3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.