1T6W: Hypothetical protein XP_346638

Rational design of a calcium-binding adhesion protein NMR, 20 structures. Determined by solution NMR. Released 15 Feb 2005.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 786
Mol. weight: 11.2 kDa
Ligands: CA
Released: 15 Feb 2005

Explore 1T6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T6W contains 2 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	14-16	3	2
α-helix	17-18	2
β-strand	27-34	8	1
β-strand	37-43	7	1
β-strand	49-50	2	1
β-strand	55-57	3	2
β-strand	63-65	3	2
α-helix	70-72	3
β-strand	74-82	9	1
β-strand	87-98	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
hypothetical protein XP_346638	A	protein	99	Rattus norvegicus	P08921 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1T6W_1 hypothetical protein XP_346638 (chains A)
RDSGTVWGALGHGIDLDIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILAN
GDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILE

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Design of a calcium-binding protein with desired structure in a cell adhesion molecule. Yang, W., Wilkins, A.L., Ye, Y. et al. J Am Chem Soc (2005) 127:2085-2093. DOI 10.1021/ja0431307 · PubMed

Other PDB entries of the same protein (UniProt P08921 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CCZ 1.8 Å, Crystal structure of the CD2-binding domain of CD58 (lymphocyte function-associated…
1A64 2.0 Å, Engineering a misfolded form of rat CD2
1CDC 2.0 Å, CD2, N-terminal domain (1-99), truncated form
1A6P 2.08 Å, Engineering of a misfolded form of CD2
2DRU 2.6 Å, Crystal structure and binding properties of the CD2 and CD244 (2B4) binding protein, CD48
1HNG 2.8 Å, Crystal structure at 2.8 Å resolution of a soluble form of the cell adhesion molecule CD2
1A7B 3.1 Å, Engineering a misfolded form of CD2

Browse structure collections

About this viewer

MolViewer shows 1T6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.