Interactions of a specific non-steroidal anti-inflammatory drug (NSAID) with group I phospholipase A2 (PLA2): Crystal structure of the complex formed between PLA2 and niflumic acid at 2.5 A resolution. Determined by X-ray diffraction at 2.5 Å resolution. Released 8 Jun 2004.
Explore 1TD7 in 3D Show helices and sheets RCSB PDB PDBe
1TD7 contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-12 | 11 | |
| α-helix | 19-22 | 4 | |
| β-strand | 25 | 1 | 1 |
| β-strand | 29 | 1 | 1 |
| α-helix | 40-56 | 17 | |
| β-strand | 70-73 | 4 | 2 |
| β-strand | 76-79 | 4 | 2 |
| α-helix | 85-103 | 19 | |
| α-helix | 108-110 | 3 | |
| β-strand | 111 | 1 | 1 |
| α-helix | 115-118 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phospholipase A2 isoform 3 | A | protein | 119 | Naja sagittifera | P60045 (AlphaFold model) |
>1TD7_1 Phospholipase A2 isoform 3 (chains A) NLYQFKNMIQCTVPSRSWQDFADYGCYCGKGGSGTPVDDLDRCCQVHDNCYNEAENISGC RPYFKTYSYECTQGTLTCKGDNNACAASVCDCDRLAAICFAGAPYNDANYNIDLKARCN
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
| NFL | 2-{[3-(trifluoromethyl)phenyl]amino}nicotinic acid | C13 H9 F3 N2 O2 | 1 |
Non-steroidal anti-inflammatory drugs as potent inhibitors of phospholipase A2: structure of the complex of phospholipase A2 with niflumic acid at 2.5 Angstroms resolution. Jabeen, T., Singh, N., Singh, R.K. et al. Acta Crystallogr D Biol Crystallogr (2005) 61:1579-1586. DOI 10.1107/S0907444905029604 · PubMed
Other PDB entries of the same protein (UniProt P60045 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1TD7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.