1THM: Thermitase

Crystal structure of thermitase at 1.4 Å resolution. Determined by X-ray diffraction at 1.37 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 1.37 Å
Organism: Thermoactinomyces vulgaris
Chains: 1
Atoms: 2,214
Mol. weight: 28.76 kDa
Ligands: CA
Released: 31 Jan 1994

Explore 1THM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1THM contains 11 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
α-helix	14-17	4
α-helix	20-24	5
β-strand	33-38	6	1
β-strand	52-57	6	1
β-strand	62	1	1
α-helix	71-80	10
β-strand	97-102	6	1
α-helix	112-124	13
β-strand	129-132	4	1
β-strand	136	1	2
α-helix	141-152	12
β-strand	156-160	5	1
β-strand	171	1	2
β-strand	178-184	7	1
α-helix	189	1
β-strand	190	1	1
α-helix	191	1
β-strand	202-205	4	1
β-strand	209-213	5	3
β-strand	217-221	5	3
α-helix	224-239	16
α-helix	245-254	10
β-strand	257	1	1
β-strand	262	1	4
β-strand	266	1	4
β-strand	269-270	2	1
α-helix	273-278	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thermitase	A	protein	279	Thermoactinomyces vulgaris	P04072 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1THM_1 THERMITASE (chains A)
YTPNDPYFSSRQYGPQKIQAPQAWDIAEGSGAKIAIVDTGVQSNHPDLAGKVVGGWDFVD
NDSTPQNGNGHGTHCAGIAAAVTNNSTGIAGTAPKASILAVRVLDNSGSGTWTAVANGIT
YAADQGAKVISLSLGGTVGNSGLQQAVNYAWNKGSVVVAAAGNAGNTAPNYPAYYSNAIA
VASTDQNDNKSSFSTYGSWVDVAAPGSSIYSTYPTSTYASLSGTSMATPHVAGVAGLLAS
QGRSASNIRAAIENTADKISGTGTYWAKGRVNAYKAVQY

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (SO4, NA) are not listed.

Primary citation

Crystal structure of thermitase at 1.4 A resolution. Teplyakov, A.V., Kuranova, I.P., Harutyunyan, E.H. et al. J Mol Biol (1990) 214:261-279. DOI 10.1016/0022-2836(90)90160-N · PubMed

Other PDB entries of the same protein (UniProt P04072 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2TEC 1.98 Å, Molecular dynamics refinement of a thermitase-eglin-C complex at 1.98 Å resolution and…
3TEC 2.0 Å, Calcium binding to thermitase. Crystallographic studies of thermitase at 0, 5 and 100 mm…
1TEC 2.2 Å, Crystallographic refinement by incorporation of molecular dynamics. The thermostable…

Browse structure collections

About this viewer

MolViewer shows 1THM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.