1TKW: Plastocyanin A

The transient complex of poplar plastocyanin with turnip cytochrome f determined with paramagnetic NMR. Determined by solution NMR. Released 24 May 2005.

Method: Solution NMR
Organisms: Populus nigra, Brassica rapa subsp. rapa
Chains: 2
Atoms: 2,706
Mol. weight: 38.72 kDa
Ligands: HEC, CU
Released: 24 May 2005

Explore 1TKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TKW contains 10 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	14-15	2	1
β-strand	18-21	4	2
β-strand	26-31	6	1
β-strand	37	1	3
β-strand	40-41	2	2
α-helix	52-54	3
β-strand	63	1	3
β-strand	69-73	5	1
β-strand	78-83	6	2
β-strand	93-98	6	2

Chain B: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
α-helix	2-8	7
β-strand	13	1	4
β-strand	19	1	4
α-helix	20-23	4
β-strand	28	1	5
β-strand	32-34	3	6
β-strand	38-39	2	5
β-strand	44-50	7	6
β-strand	59-60	2	7
β-strand	66-67	2	7
β-strand	70-76	7	5
α-helix	77-78	2
β-strand	82-83	2	6
α-helix	84-85	2
α-helix	86-88	3
α-helix	91-94	4
β-strand	103-106	4	5
β-strand	109-119	11	5
β-strand	125-131	7	6
α-helix	135-137	3
β-strand	145-154	10	5
β-strand	159	1	8
β-strand	165	1	8
α-helix	170-171	2
β-strand	172	1	9
α-helix	173	1
β-strand	177-184	8	10
β-strand	190-196	7	10
β-strand	201-207	7	10
β-strand	213	1	11
β-strand	220-221	2	10
β-strand	226	1	9
β-strand	228	1	11
β-strand	235-245	11	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plastocyanin A	A	protein	99	Populus nigra	P00299 (AlphaFold model)
Cytochrome f	B	protein	252	Brassica rapa subsp. rapa	P36438 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1TKW_1 Plastocyanin A (chains A)
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEE
DLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN

Sequence of entity 2 (B), FASTA

>1TKW_2 Cytochrome f (chains B)
YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV
LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG
QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS
KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD
AEIVLQDPLRVQ

Ligands and cofactors

ID	Name	Formula	Copies
HEC	Heme C	C34 H36 Fe N4 O4	1
CU	Copper (II) ion	Cu	1

Primary citation

The transient complex of poplar plastocyanin with cytochrome f: effects of ionic strength and pH. Lange, C., Cornvik, T., Diaz-Moreno, I. et al. Biochim Biophys Acta (2005) 1707:179-188. DOI 10.1016/j.bbabio.2004.12.002 · PubMed

Other PDB entries of the same protein (UniProt P00299 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4DP9 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 6.0
4DPB 1.0 Å, The 1.00 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 8.0
4DPA 1.05 Å, The 1.05 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 6.0
4DPC 1.06 Å, The 1.06 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 8.0
4DP8 1.07 Å, The 1.07 Angstrom crystal structure of reduced (CuI) poplar plastocyanin A at pH 4.0
4DP7 1.08 Å, The 1.08 Angstrom crystal structure of oxidized (CuII) poplar plastocyanin A at pH 4.0
1PLC 1.33 Å, Accuracy and precision in protein crystal structure analysis: restrained least-squares…
1JXG 1.6 Å, The 1.6 A Resolution Crystal Structure of a Mutant Poplar Plastocyanin Bearing a 21-25…
1PNC 1.6 Å, Accuracy and precision in protein crystal structure analysis: two independent…
1PND 1.6 Å, Accuracy and precision in protein crystal structure analysis: two independent…
2PCY 1.8 Å, The crystal structure of poplar apoplastocyanin at 1.8-Å resolution. The geometry of the…
5PCY 1.8 Å, Crystal structure analyses of reduced (CUI) poplar plastocyanin at six PH values

Browse structure collections

About this viewer

MolViewer shows 1TKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.